Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6RHL4

Protein Details
Accession A0A2Z6RHL4    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
18-37WIFRRSRTPFRGRPLRKEKSBasic
NLS Segment(s)
Subcellular Location(s) mito 11.5, cyto_mito 9.5, nucl 7, cyto 6.5
Family & Domain DBs
Amino Acid Sequences MRLWTLFRKSGVSFEADWIFRRSRTPFRGRPLRKEKSLEFRGGLAQNLEADWYFEGLEFRGGLVFRRSGTLVRNRPWYFEGPELEADQRWTPPRGGPGIIPKIKKNCLLVFINEMLINVSNSFFLICVFPEVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.29
3 0.26
4 0.27
5 0.27
6 0.27
7 0.24
8 0.28
9 0.3
10 0.35
11 0.43
12 0.51
13 0.54
14 0.62
15 0.73
16 0.74
17 0.79
18 0.8
19 0.79
20 0.76
21 0.75
22 0.71
23 0.7
24 0.69
25 0.61
26 0.52
27 0.45
28 0.43
29 0.37
30 0.32
31 0.22
32 0.17
33 0.14
34 0.12
35 0.12
36 0.07
37 0.06
38 0.06
39 0.06
40 0.05
41 0.05
42 0.06
43 0.05
44 0.06
45 0.05
46 0.05
47 0.05
48 0.05
49 0.06
50 0.07
51 0.08
52 0.08
53 0.09
54 0.1
55 0.1
56 0.14
57 0.22
58 0.26
59 0.29
60 0.38
61 0.37
62 0.39
63 0.4
64 0.39
65 0.33
66 0.32
67 0.3
68 0.23
69 0.24
70 0.23
71 0.21
72 0.18
73 0.17
74 0.14
75 0.15
76 0.16
77 0.16
78 0.16
79 0.17
80 0.21
81 0.21
82 0.22
83 0.22
84 0.28
85 0.36
86 0.4
87 0.4
88 0.42
89 0.46
90 0.49
91 0.51
92 0.47
93 0.4
94 0.42
95 0.42
96 0.39
97 0.37
98 0.34
99 0.31
100 0.26
101 0.23
102 0.18
103 0.16
104 0.15
105 0.1
106 0.1
107 0.08
108 0.08
109 0.08
110 0.07
111 0.07
112 0.07
113 0.07