Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6R7Y2

Protein Details
Accession A0A2Z6R7Y2    Localization Confidence Medium Confidence Score 12.9
NoLS Segment(s)
PositionSequenceProtein Nature
6-39NDKHNVFKYRNLKSQRSKRNRRGKNKWVLKEKTAHydrophilic
NLS Segment(s)
PositionSequence
18-32KSQRSKRNRRGKNKW
Subcellular Location(s) nucl 18.5, cyto_nucl 13, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012942  SRR1-like  
IPR040044  SRR1L  
Pfam View protein in Pfam  
PF07985  SRR1  
Amino Acid Sequences MDDVLNDKHNVFKYRNLKSQRSKRNRRGKNKWVLKEKTAEDFISYIEEKRQTLLQSGFFQEVQETINSKLFPPHLPKIEDIVCYGIGSIEKSIISQYQLALVLILRDLFEITGKAYAYDPVSTPIDLEIFLHYEINTINANEQRDQSRTKLFFICHIAHLDYITT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.6
3 0.63
4 0.67
5 0.73
6 0.81
7 0.83
8 0.85
9 0.88
10 0.89
11 0.92
12 0.93
13 0.93
14 0.93
15 0.93
16 0.93
17 0.92
18 0.91
19 0.9
20 0.85
21 0.79
22 0.75
23 0.67
24 0.62
25 0.54
26 0.45
27 0.36
28 0.3
29 0.26
30 0.22
31 0.2
32 0.15
33 0.15
34 0.17
35 0.16
36 0.17
37 0.19
38 0.16
39 0.2
40 0.21
41 0.21
42 0.22
43 0.23
44 0.24
45 0.21
46 0.2
47 0.16
48 0.14
49 0.11
50 0.1
51 0.09
52 0.09
53 0.12
54 0.12
55 0.12
56 0.14
57 0.15
58 0.17
59 0.22
60 0.25
61 0.27
62 0.28
63 0.29
64 0.3
65 0.3
66 0.27
67 0.21
68 0.18
69 0.14
70 0.12
71 0.11
72 0.08
73 0.06
74 0.06
75 0.05
76 0.05
77 0.04
78 0.05
79 0.05
80 0.06
81 0.07
82 0.07
83 0.07
84 0.08
85 0.08
86 0.08
87 0.07
88 0.07
89 0.06
90 0.05
91 0.05
92 0.04
93 0.04
94 0.04
95 0.04
96 0.04
97 0.05
98 0.05
99 0.07
100 0.07
101 0.07
102 0.08
103 0.1
104 0.11
105 0.11
106 0.11
107 0.13
108 0.14
109 0.13
110 0.13
111 0.12
112 0.11
113 0.1
114 0.11
115 0.08
116 0.09
117 0.09
118 0.1
119 0.09
120 0.09
121 0.09
122 0.11
123 0.1
124 0.09
125 0.13
126 0.16
127 0.19
128 0.2
129 0.23
130 0.25
131 0.27
132 0.3
133 0.31
134 0.37
135 0.36
136 0.39
137 0.4
138 0.38
139 0.4
140 0.43
141 0.42
142 0.35
143 0.36
144 0.33
145 0.29