Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6R382

Protein Details
Accession A0A2Z6R382    Localization Confidence High Confidence Score 18.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-70NLSASKSKSGRKKAIKHRTTVHydrophilic
171-195VTGNSKDRRGYKKSKTRNPGVKIWFHydrophilic
NLS Segment(s)
PositionSequence
56-65SKSGRKKAIK
176-186KDRRGYKKSKT
Subcellular Location(s) nucl 23, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MSVNIYNLKSESISNKSLDIEKKADIQDNSVPRSCVRSSRSYRPYQNENNLSASKSKSGRKKAIKHRTTVTLKEVTINDNTQFDSLKSQKSKDLQNVEHNHEGKEEIKFQLLRPEELNRKESWHSYVNKSRSPNYILCRFQIKERKIFQERSEEALIKKVRFYKIVEVKKVTGNSKDRRGYKKSKTRNPGVKIWFTGITGMNTINNKKPEENPIAANIVWEDRTCDIHIIDPSEDYA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.29
4 0.34
5 0.36
6 0.35
7 0.33
8 0.31
9 0.36
10 0.37
11 0.41
12 0.36
13 0.36
14 0.38
15 0.41
16 0.44
17 0.4
18 0.38
19 0.32
20 0.37
21 0.35
22 0.35
23 0.34
24 0.4
25 0.45
26 0.54
27 0.62
28 0.65
29 0.72
30 0.71
31 0.75
32 0.74
33 0.77
34 0.72
35 0.66
36 0.62
37 0.55
38 0.49
39 0.43
40 0.36
41 0.31
42 0.31
43 0.36
44 0.4
45 0.47
46 0.56
47 0.63
48 0.71
49 0.77
50 0.83
51 0.81
52 0.77
53 0.73
54 0.73
55 0.69
56 0.63
57 0.57
58 0.5
59 0.44
60 0.43
61 0.39
62 0.31
63 0.28
64 0.26
65 0.21
66 0.18
67 0.18
68 0.15
69 0.14
70 0.12
71 0.16
72 0.17
73 0.23
74 0.24
75 0.25
76 0.3
77 0.33
78 0.39
79 0.39
80 0.45
81 0.42
82 0.49
83 0.52
84 0.53
85 0.55
86 0.5
87 0.43
88 0.36
89 0.33
90 0.25
91 0.22
92 0.19
93 0.13
94 0.15
95 0.15
96 0.15
97 0.21
98 0.2
99 0.2
100 0.19
101 0.24
102 0.27
103 0.3
104 0.32
105 0.25
106 0.27
107 0.28
108 0.27
109 0.26
110 0.26
111 0.27
112 0.31
113 0.38
114 0.39
115 0.42
116 0.44
117 0.42
118 0.39
119 0.41
120 0.39
121 0.36
122 0.4
123 0.37
124 0.36
125 0.39
126 0.36
127 0.39
128 0.43
129 0.41
130 0.42
131 0.45
132 0.52
133 0.52
134 0.56
135 0.51
136 0.52
137 0.5
138 0.47
139 0.45
140 0.39
141 0.33
142 0.37
143 0.37
144 0.27
145 0.29
146 0.29
147 0.28
148 0.29
149 0.32
150 0.35
151 0.41
152 0.49
153 0.51
154 0.49
155 0.49
156 0.51
157 0.52
158 0.45
159 0.43
160 0.45
161 0.46
162 0.52
163 0.57
164 0.6
165 0.64
166 0.69
167 0.71
168 0.73
169 0.76
170 0.78
171 0.81
172 0.83
173 0.85
174 0.87
175 0.83
176 0.81
177 0.78
178 0.72
179 0.64
180 0.58
181 0.49
182 0.39
183 0.36
184 0.29
185 0.23
186 0.18
187 0.17
188 0.17
189 0.2
190 0.23
191 0.27
192 0.29
193 0.31
194 0.33
195 0.36
196 0.41
197 0.45
198 0.45
199 0.41
200 0.4
201 0.4
202 0.37
203 0.33
204 0.26
205 0.21
206 0.18
207 0.16
208 0.16
209 0.14
210 0.18
211 0.18
212 0.19
213 0.18
214 0.21
215 0.24
216 0.25
217 0.24