Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A2Z6QZC4

Protein Details
Accession A0A2Z6QZC4    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
9-41LEIARRKDAKSVRIKKKKKKNGPSKVKFKLRCSBasic
NLS Segment(s)
PositionSequence
13-37RRKDAKSVRIKKKKKKNGPSKVKFK
Subcellular Location(s) nucl 17, cyto_nucl 12.5, cyto 6, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MIDDIKYFLEIARRKDAKSVRIKKKKKKNGPSKVKFKLRCSKYLYTFVIEDAEKAEKLQKSLPPGLTVTDV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.45
3 0.49
4 0.5
5 0.57
6 0.63
7 0.63
8 0.72
9 0.82
10 0.84
11 0.9
12 0.92
13 0.92
14 0.92
15 0.92
16 0.92
17 0.93
18 0.93
19 0.92
20 0.9
21 0.89
22 0.83
23 0.8
24 0.78
25 0.71
26 0.68
27 0.65
28 0.63
29 0.58
30 0.6
31 0.54
32 0.46
33 0.43
34 0.36
35 0.31
36 0.24
37 0.2
38 0.14
39 0.15
40 0.12
41 0.12
42 0.18
43 0.16
44 0.19
45 0.24
46 0.25
47 0.31
48 0.37
49 0.39
50 0.35
51 0.35