Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A2Z6QW10

Protein Details
Accession A0A2Z6QW10    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
13-37QHLKTNKHKNNKSAIEQKKNRSNNSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 14.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR033375  Cggbp1  
IPR007021  DUF659  
Gene Ontology GO:0005634  C:nucleus  
GO:0003690  F:double-stranded DNA binding  
GO:0006357  P:regulation of transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF04937  DUF659  
Amino Acid Sequences MEGISLKHKGVDQHLKTNKHKNNKSAIEQKKNRSNNSSQQQQSTLETFENINSERDELNLELVKVFTAADIPLEKINKLRPFFRKYCKNGGTVVGANQLREKYLPKLYDQEVEKLNNSLKNEKICIIVDETTDACGRAAVNVLFAFKDQTKLVATEHIIVVNNTTISQMILSTLQKYQVPFNNVLLFITDNAAYMVKAFKNLSPTQLCPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.64
3 0.7
4 0.77
5 0.76
6 0.76
7 0.78
8 0.76
9 0.78
10 0.77
11 0.79
12 0.78
13 0.8
14 0.8
15 0.81
16 0.83
17 0.82
18 0.82
19 0.79
20 0.75
21 0.73
22 0.72
23 0.72
24 0.73
25 0.66
26 0.62
27 0.59
28 0.53
29 0.49
30 0.4
31 0.33
32 0.23
33 0.21
34 0.18
35 0.16
36 0.17
37 0.15
38 0.14
39 0.13
40 0.14
41 0.13
42 0.13
43 0.14
44 0.12
45 0.14
46 0.13
47 0.13
48 0.11
49 0.11
50 0.11
51 0.09
52 0.08
53 0.05
54 0.05
55 0.04
56 0.05
57 0.06
58 0.07
59 0.1
60 0.11
61 0.11
62 0.13
63 0.19
64 0.24
65 0.26
66 0.31
67 0.36
68 0.44
69 0.5
70 0.57
71 0.6
72 0.6
73 0.68
74 0.64
75 0.59
76 0.53
77 0.48
78 0.42
79 0.33
80 0.28
81 0.24
82 0.21
83 0.19
84 0.19
85 0.17
86 0.14
87 0.14
88 0.15
89 0.12
90 0.17
91 0.18
92 0.17
93 0.21
94 0.22
95 0.27
96 0.26
97 0.26
98 0.24
99 0.24
100 0.23
101 0.21
102 0.21
103 0.19
104 0.2
105 0.2
106 0.2
107 0.21
108 0.22
109 0.21
110 0.21
111 0.19
112 0.18
113 0.17
114 0.15
115 0.13
116 0.13
117 0.12
118 0.12
119 0.11
120 0.1
121 0.08
122 0.07
123 0.07
124 0.06
125 0.08
126 0.07
127 0.08
128 0.08
129 0.09
130 0.08
131 0.09
132 0.11
133 0.09
134 0.12
135 0.1
136 0.12
137 0.13
138 0.14
139 0.14
140 0.16
141 0.16
142 0.16
143 0.16
144 0.16
145 0.15
146 0.14
147 0.15
148 0.12
149 0.11
150 0.09
151 0.09
152 0.07
153 0.07
154 0.07
155 0.06
156 0.06
157 0.09
158 0.1
159 0.11
160 0.12
161 0.15
162 0.17
163 0.18
164 0.23
165 0.27
166 0.31
167 0.32
168 0.35
169 0.36
170 0.34
171 0.33
172 0.28
173 0.22
174 0.18
175 0.17
176 0.13
177 0.1
178 0.1
179 0.11
180 0.09
181 0.09
182 0.12
183 0.11
184 0.15
185 0.16
186 0.18
187 0.25
188 0.26
189 0.33
190 0.35