Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317ST92

Protein Details
Accession A0A317ST92    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTLNYPEYDPKRKKRSMPNCPIPMGTHydrophilic
NLS Segment(s)
PositionSequence
121-132PRWGKALYRRAR
Subcellular Location(s) cyto 15.5, cyto_nucl 11.5, nucl 6.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011990  TPR-like_helical_dom_sf  
Amino Acid Sequences MTLNYPEYDPKRKKRSMPNCPIPMGTKGEAHKTEYHIIIIVYTAKXLLTESTSYRISGNRLFNSNFLLPALDAYKLALTSCPIYLVHEVATIYANIAAVELKLQRYPAAVKSATKALEGRPRWGKALYRRARGREGIGGWAELEGALEDYKAVESLAAGAGGAPVGEIGEKELEIVREKIRWLPGRIEEVRDVETAEVVGKLKQMGEGLLRPFGISTSDFGMVKGADGAYSLQFRRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.86
4 0.88
5 0.88
6 0.85
7 0.8
8 0.74
9 0.66
10 0.59
11 0.53
12 0.44
13 0.38
14 0.34
15 0.39
16 0.38
17 0.39
18 0.38
19 0.37
20 0.39
21 0.35
22 0.33
23 0.26
24 0.24
25 0.2
26 0.17
27 0.14
28 0.1
29 0.09
30 0.08
31 0.07
32 0.07
33 0.07
34 0.07
35 0.09
36 0.1
37 0.13
38 0.16
39 0.16
40 0.17
41 0.19
42 0.21
43 0.25
44 0.3
45 0.3
46 0.32
47 0.33
48 0.32
49 0.36
50 0.32
51 0.26
52 0.19
53 0.17
54 0.12
55 0.13
56 0.13
57 0.08
58 0.07
59 0.08
60 0.08
61 0.07
62 0.07
63 0.07
64 0.07
65 0.08
66 0.08
67 0.08
68 0.08
69 0.1
70 0.11
71 0.11
72 0.1
73 0.1
74 0.1
75 0.09
76 0.1
77 0.07
78 0.07
79 0.06
80 0.06
81 0.04
82 0.05
83 0.04
84 0.04
85 0.05
86 0.06
87 0.06
88 0.07
89 0.07
90 0.07
91 0.08
92 0.1
93 0.11
94 0.15
95 0.15
96 0.15
97 0.17
98 0.2
99 0.19
100 0.18
101 0.17
102 0.15
103 0.23
104 0.23
105 0.27
106 0.29
107 0.3
108 0.3
109 0.31
110 0.33
111 0.34
112 0.44
113 0.45
114 0.49
115 0.52
116 0.55
117 0.57
118 0.53
119 0.46
120 0.4
121 0.34
122 0.28
123 0.24
124 0.2
125 0.16
126 0.14
127 0.12
128 0.07
129 0.07
130 0.03
131 0.04
132 0.03
133 0.03
134 0.03
135 0.04
136 0.04
137 0.04
138 0.04
139 0.03
140 0.03
141 0.04
142 0.04
143 0.04
144 0.04
145 0.03
146 0.03
147 0.03
148 0.03
149 0.02
150 0.02
151 0.02
152 0.02
153 0.02
154 0.04
155 0.04
156 0.04
157 0.05
158 0.06
159 0.08
160 0.1
161 0.13
162 0.13
163 0.14
164 0.16
165 0.19
166 0.26
167 0.31
168 0.31
169 0.35
170 0.38
171 0.45
172 0.46
173 0.45
174 0.4
175 0.37
176 0.36
177 0.3
178 0.27
179 0.18
180 0.17
181 0.13
182 0.11
183 0.1
184 0.08
185 0.08
186 0.09
187 0.09
188 0.09
189 0.1
190 0.1
191 0.11
192 0.14
193 0.18
194 0.19
195 0.2
196 0.2
197 0.18
198 0.18
199 0.17
200 0.15
201 0.12
202 0.12
203 0.13
204 0.16
205 0.16
206 0.16
207 0.18
208 0.15
209 0.15
210 0.14
211 0.11
212 0.08
213 0.09
214 0.1
215 0.11
216 0.16