Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SU56

Protein Details
Accession A0A317SU56   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-57MGLRLRQKSPSPSRSPRQQERHRQQQPSPPPTPQPRKSLRKARKNTHRSRSRSPSGLHydrophilic
NLS Segment(s)
PositionSequence
21-52RHRQQQPSPPPTPQPRKSLRKARKNTHRSRSR
Subcellular Location(s) nucl 24.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MGLRLRQKSPSPSRSPRQQERHRQQQPSPPPTPQPRKSLRKARKNTHRSRSRSPSGLNSAIALPSNIIPYGVLFQDDEPEDEGYSSPPSTPTDPPPHMQLDGWRMVPERGLAMELMFGNMDADLIDEITGASSSDEMDIDEPATPSNTRTNARIPHTRLDSSPSSETSSSSMNSRDRRYSENGFGGRVVDENYD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.85
3 0.85
4 0.86
5 0.87
6 0.88
7 0.89
8 0.92
9 0.9
10 0.87
11 0.83
12 0.83
13 0.83
14 0.8
15 0.74
16 0.68
17 0.67
18 0.71
19 0.75
20 0.7
21 0.69
22 0.71
23 0.75
24 0.81
25 0.83
26 0.83
27 0.83
28 0.87
29 0.88
30 0.89
31 0.91
32 0.91
33 0.91
34 0.9
35 0.87
36 0.87
37 0.85
38 0.81
39 0.75
40 0.68
41 0.65
42 0.62
43 0.56
44 0.46
45 0.38
46 0.31
47 0.26
48 0.23
49 0.15
50 0.09
51 0.07
52 0.08
53 0.07
54 0.06
55 0.06
56 0.06
57 0.07
58 0.07
59 0.06
60 0.06
61 0.06
62 0.08
63 0.09
64 0.09
65 0.09
66 0.1
67 0.09
68 0.09
69 0.09
70 0.08
71 0.08
72 0.08
73 0.07
74 0.07
75 0.09
76 0.12
77 0.14
78 0.18
79 0.25
80 0.27
81 0.27
82 0.29
83 0.29
84 0.26
85 0.25
86 0.22
87 0.19
88 0.19
89 0.18
90 0.15
91 0.15
92 0.14
93 0.14
94 0.12
95 0.08
96 0.06
97 0.07
98 0.06
99 0.05
100 0.06
101 0.06
102 0.06
103 0.05
104 0.05
105 0.04
106 0.04
107 0.04
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.03
119 0.03
120 0.04
121 0.04
122 0.04
123 0.05
124 0.05
125 0.05
126 0.06
127 0.07
128 0.07
129 0.07
130 0.09
131 0.08
132 0.1
133 0.15
134 0.19
135 0.2
136 0.22
137 0.29
138 0.34
139 0.4
140 0.47
141 0.46
142 0.49
143 0.53
144 0.52
145 0.47
146 0.46
147 0.43
148 0.4
149 0.39
150 0.33
151 0.31
152 0.29
153 0.3
154 0.25
155 0.24
156 0.2
157 0.2
158 0.23
159 0.27
160 0.33
161 0.38
162 0.43
163 0.44
164 0.49
165 0.53
166 0.55
167 0.55
168 0.57
169 0.53
170 0.47
171 0.44
172 0.4
173 0.33
174 0.27