Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SCJ7

Protein Details
Accession A0A317SCJ7    Localization Confidence Medium Confidence Score 14.9
NoLS Segment(s)
PositionSequenceProtein Nature
65-89KIEECRERRKWKWKNKKWWNEEIEEBasic
NLS Segment(s)
PositionSequence
71-84ERRKWKWKNKKWWN
89-128EEYRRGKERLKEWRTKGGKERKEEIRRGKRELGRKIKTAK
Subcellular Location(s) nucl 17, cyto_nucl 11, mito 7
Family & Domain DBs
Amino Acid Sequences MEVRVCGWRVGKEEEKKGRVDWERFKAELKVTEKWKGWEERVEKQRNREELEKVIEEVEGWIKGKIEECRERRKWKWKNKKWWNEEIEEEYRRGKERLKEWRTKGGKERKEEIRRGKRELGRKIKTAKGDHWERFLGEMGV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.59
4 0.56
5 0.58
6 0.57
7 0.58
8 0.57
9 0.56
10 0.58
11 0.57
12 0.57
13 0.51
14 0.47
15 0.46
16 0.41
17 0.4
18 0.39
19 0.45
20 0.44
21 0.44
22 0.47
23 0.44
24 0.42
25 0.43
26 0.44
27 0.46
28 0.54
29 0.61
30 0.58
31 0.61
32 0.66
33 0.63
34 0.63
35 0.58
36 0.51
37 0.46
38 0.47
39 0.4
40 0.33
41 0.28
42 0.22
43 0.18
44 0.15
45 0.11
46 0.08
47 0.07
48 0.07
49 0.07
50 0.08
51 0.11
52 0.13
53 0.18
54 0.26
55 0.3
56 0.4
57 0.46
58 0.54
59 0.58
60 0.66
61 0.7
62 0.73
63 0.8
64 0.8
65 0.85
66 0.88
67 0.91
68 0.88
69 0.88
70 0.81
71 0.73
72 0.66
73 0.6
74 0.55
75 0.46
76 0.4
77 0.32
78 0.29
79 0.28
80 0.26
81 0.25
82 0.26
83 0.33
84 0.43
85 0.5
86 0.57
87 0.6
88 0.69
89 0.68
90 0.68
91 0.7
92 0.69
93 0.68
94 0.66
95 0.69
96 0.69
97 0.73
98 0.76
99 0.77
100 0.77
101 0.76
102 0.76
103 0.78
104 0.75
105 0.75
106 0.77
107 0.77
108 0.72
109 0.73
110 0.73
111 0.7
112 0.71
113 0.67
114 0.63
115 0.62
116 0.66
117 0.62
118 0.61
119 0.57
120 0.49
121 0.45