Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SSK4

Protein Details
Accession A0A317SSK4    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
62-87MGKKGRGILGNRRKRRKRTLGEEIGEBasic
NLS Segment(s)
PositionSequence
62-79MGKKGRGILGNRRKRRKR
Subcellular Location(s) nucl 21, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012337  RNaseH-like_sf  
IPR002156  RNaseH_domain  
IPR036397  RNaseH_sf  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
PROSITE View protein in PROSITE  
PS50879  RNASE_H_1  
Amino Acid Sequences MGKELIGNGWEIRLEWIPGHVGLEENEEVDEWAQEGCFEEEEEEKGNEKGKGEENMERILGMGKKGRGILGNRRKRRKRTLGEEIGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.12
4 0.13
5 0.13
6 0.13
7 0.1
8 0.1
9 0.09
10 0.13
11 0.11
12 0.1
13 0.1
14 0.09
15 0.09
16 0.09
17 0.08
18 0.05
19 0.05
20 0.04
21 0.04
22 0.05
23 0.06
24 0.06
25 0.06
26 0.06
27 0.07
28 0.08
29 0.1
30 0.09
31 0.09
32 0.1
33 0.12
34 0.12
35 0.12
36 0.13
37 0.15
38 0.18
39 0.2
40 0.24
41 0.24
42 0.24
43 0.23
44 0.21
45 0.18
46 0.18
47 0.15
48 0.13
49 0.15
50 0.15
51 0.17
52 0.17
53 0.19
54 0.2
55 0.25
56 0.34
57 0.41
58 0.51
59 0.59
60 0.7
61 0.78
62 0.83
63 0.89
64 0.89
65 0.89
66 0.88
67 0.89