Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A1CNI1

Protein Details
Accession A1CNI1    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAAGAGKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
6-19GKQKKKWSKGKVKD
Subcellular Location(s) cyto 12, mito 9, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
IPR036390  WH_DNA-bd_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
KEGG act:ACLA_019070  -  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAAGAGKQKKKWSKGKVKDKAQHAVVLEKQTAERLQKDVQSYRLITVATLVDRLKINGSLARQALADLEEKGQIKKVVGHSKMTIYTRAVAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.88
3 0.89
4 0.9
5 0.89
6 0.85
7 0.82
8 0.73
9 0.66
10 0.56
11 0.51
12 0.43
13 0.39
14 0.32
15 0.25
16 0.23
17 0.21
18 0.22
19 0.19
20 0.18
21 0.18
22 0.2
23 0.23
24 0.26
25 0.27
26 0.27
27 0.27
28 0.26
29 0.23
30 0.22
31 0.19
32 0.14
33 0.13
34 0.11
35 0.08
36 0.09
37 0.08
38 0.09
39 0.09
40 0.09
41 0.09
42 0.09
43 0.1
44 0.11
45 0.12
46 0.14
47 0.14
48 0.15
49 0.14
50 0.13
51 0.13
52 0.11
53 0.11
54 0.08
55 0.09
56 0.12
57 0.13
58 0.14
59 0.16
60 0.16
61 0.16
62 0.21
63 0.29
64 0.35
65 0.37
66 0.41
67 0.4
68 0.43
69 0.48
70 0.44
71 0.39
72 0.32
73 0.32