Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SX19

Protein Details
Accession A0A317SX19    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
4-23DAGIRRPRTRRQHLFAKELKBasic
NLS Segment(s)
Subcellular Location(s) mito 16, cyto 8.5, cyto_nucl 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR003195  TFIID_TAF13  
Gene Ontology GO:0005634  C:nucleus  
GO:0046982  F:protein heterodimerization activity  
GO:0006366  P:transcription by RNA polymerase II  
Pfam View protein in Pfam  
PF02269  TFIID-18kDa  
CDD cd07978  TAF13  
Amino Acid Sequences MAADAGIRRPRTRRQHLFAKELKSLMYAFGDDPDPLPESVQVLDEIVTDYIVDMCHDAARMASRGGRNKIKVDDFKFALRKDQRKLGRVEELLIMSKVIADARKQFDDKQEVSDVASAGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.68
2 0.75
3 0.78
4 0.82
5 0.78
6 0.73
7 0.65
8 0.56
9 0.49
10 0.39
11 0.33
12 0.24
13 0.19
14 0.14
15 0.11
16 0.12
17 0.12
18 0.11
19 0.11
20 0.11
21 0.12
22 0.11
23 0.11
24 0.1
25 0.1
26 0.1
27 0.1
28 0.08
29 0.07
30 0.07
31 0.06
32 0.07
33 0.06
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.04
46 0.05
47 0.06
48 0.06
49 0.09
50 0.12
51 0.18
52 0.23
53 0.28
54 0.29
55 0.32
56 0.36
57 0.39
58 0.42
59 0.41
60 0.4
61 0.37
62 0.41
63 0.42
64 0.38
65 0.42
66 0.43
67 0.46
68 0.45
69 0.52
70 0.53
71 0.54
72 0.58
73 0.54
74 0.53
75 0.48
76 0.45
77 0.39
78 0.33
79 0.29
80 0.26
81 0.2
82 0.12
83 0.11
84 0.1
85 0.09
86 0.1
87 0.11
88 0.17
89 0.23
90 0.28
91 0.3
92 0.33
93 0.39
94 0.46
95 0.44
96 0.43
97 0.41
98 0.37
99 0.36
100 0.35