Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SGS8

Protein Details
Accession A0A317SGS8   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
75-94YTKYHTKSRRPRPTVYPSPSHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 15, mito 8, cyto 4, mito_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR014044  CAP_domain  
IPR035940  CAP_sf  
IPR001283  CRISP-related  
Pfam View protein in Pfam  
PF00188  CAP  
Amino Acid Sequences MRVAYTTILSAALAASALAFPFRGANQKRDEALEIVTECTTVLVTQYVTAGPSPSSSPEPVQVNNDDVPAPAEEYTKYHTKSRRPRPTVYPSPSQAPETTPPPPAVVTPPIETPIPTSTPSTTLKPVTVSSVAPAPTTPSVSTSGAPAPDSGSFEAEVLAAHNDKRALHGVPALTYDKALADYAAGVCSSCRFEHSNGPHGENLAAGYSSPSAAIQAWYDEEKLYSYSSGGFSSETGHFTQMVWKSATKLGCAVKACNGANGTPGTFLTCNYDTGNVIGQFQANVLPPK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.04
5 0.05
6 0.05
7 0.05
8 0.07
9 0.09
10 0.18
11 0.22
12 0.29
13 0.35
14 0.4
15 0.41
16 0.42
17 0.44
18 0.36
19 0.33
20 0.3
21 0.25
22 0.22
23 0.2
24 0.17
25 0.14
26 0.12
27 0.11
28 0.07
29 0.07
30 0.06
31 0.06
32 0.07
33 0.08
34 0.08
35 0.08
36 0.09
37 0.09
38 0.08
39 0.09
40 0.1
41 0.12
42 0.15
43 0.16
44 0.17
45 0.22
46 0.25
47 0.25
48 0.28
49 0.27
50 0.27
51 0.26
52 0.26
53 0.2
54 0.17
55 0.17
56 0.13
57 0.13
58 0.1
59 0.1
60 0.1
61 0.11
62 0.15
63 0.2
64 0.22
65 0.27
66 0.33
67 0.42
68 0.52
69 0.62
70 0.69
71 0.69
72 0.74
73 0.76
74 0.8
75 0.8
76 0.75
77 0.71
78 0.62
79 0.61
80 0.57
81 0.49
82 0.4
83 0.33
84 0.3
85 0.27
86 0.27
87 0.24
88 0.22
89 0.21
90 0.2
91 0.18
92 0.17
93 0.17
94 0.17
95 0.17
96 0.16
97 0.17
98 0.17
99 0.16
100 0.16
101 0.15
102 0.14
103 0.14
104 0.15
105 0.14
106 0.18
107 0.2
108 0.2
109 0.2
110 0.19
111 0.19
112 0.19
113 0.18
114 0.17
115 0.16
116 0.14
117 0.12
118 0.13
119 0.13
120 0.12
121 0.11
122 0.11
123 0.1
124 0.11
125 0.11
126 0.1
127 0.12
128 0.13
129 0.13
130 0.12
131 0.13
132 0.12
133 0.12
134 0.1
135 0.09
136 0.08
137 0.1
138 0.09
139 0.09
140 0.08
141 0.08
142 0.08
143 0.07
144 0.06
145 0.05
146 0.06
147 0.05
148 0.05
149 0.06
150 0.07
151 0.07
152 0.09
153 0.11
154 0.11
155 0.11
156 0.13
157 0.13
158 0.12
159 0.15
160 0.14
161 0.12
162 0.11
163 0.11
164 0.09
165 0.09
166 0.09
167 0.06
168 0.04
169 0.05
170 0.05
171 0.06
172 0.05
173 0.04
174 0.04
175 0.06
176 0.08
177 0.07
178 0.1
179 0.12
180 0.15
181 0.24
182 0.28
183 0.36
184 0.36
185 0.39
186 0.36
187 0.34
188 0.32
189 0.23
190 0.19
191 0.11
192 0.09
193 0.06
194 0.06
195 0.06
196 0.06
197 0.06
198 0.05
199 0.06
200 0.06
201 0.07
202 0.06
203 0.07
204 0.09
205 0.1
206 0.11
207 0.1
208 0.1
209 0.1
210 0.11
211 0.11
212 0.1
213 0.09
214 0.1
215 0.11
216 0.11
217 0.11
218 0.1
219 0.09
220 0.13
221 0.14
222 0.14
223 0.14
224 0.15
225 0.14
226 0.14
227 0.21
228 0.21
229 0.23
230 0.23
231 0.22
232 0.25
233 0.29
234 0.3
235 0.24
236 0.27
237 0.27
238 0.3
239 0.31
240 0.3
241 0.31
242 0.37
243 0.36
244 0.34
245 0.33
246 0.28
247 0.29
248 0.28
249 0.23
250 0.18
251 0.17
252 0.17
253 0.16
254 0.16
255 0.2
256 0.2
257 0.21
258 0.21
259 0.23
260 0.2
261 0.21
262 0.26
263 0.2
264 0.19
265 0.18
266 0.18
267 0.16
268 0.16
269 0.17