Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1C5R2

Protein Details
Accession A1C5R2   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
50-69LPECIQTKRKPIRWQPHISAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto 7, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR002575  Aminoglycoside_PTrfase  
IPR011009  Kinase-like_dom_sf  
KEGG act:ACLA_004440  -  
Pfam View protein in Pfam  
PF01636  APH  
Amino Acid Sequences MTGEGEQARLPRSKIPNPFSFIVKESSFFQNGINYHHQMKCRHALRRNILPECIQTKRKPIRWQPHISAQLSEAQCLYAVRQSLKGDVPVPEVYGWRTEGNEKYIYMEYVNGTSLEQVWPIMGHEDKAGICRELRKIYQRLRQVEQDPEDPFIGNITKGPLYDRAFHVNYMHEADPFATVRDFHDWFTFLHRRPMSDPYSVPVEPFRHDLLDDCTIKFTHGDLHRSNIIVTPTPPYRILVVVDWEQSGWLPEYWESRKAQYTADRGESWSTTYLPEILDQFASTWDPWDYYTSAMGC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.57
3 0.6
4 0.63
5 0.63
6 0.58
7 0.53
8 0.47
9 0.43
10 0.36
11 0.3
12 0.28
13 0.31
14 0.29
15 0.26
16 0.25
17 0.25
18 0.26
19 0.3
20 0.33
21 0.3
22 0.35
23 0.39
24 0.43
25 0.42
26 0.47
27 0.5
28 0.52
29 0.58
30 0.59
31 0.65
32 0.68
33 0.74
34 0.76
35 0.7
36 0.65
37 0.58
38 0.56
39 0.52
40 0.5
41 0.47
42 0.41
43 0.48
44 0.55
45 0.61
46 0.65
47 0.7
48 0.74
49 0.78
50 0.84
51 0.79
52 0.79
53 0.79
54 0.7
55 0.61
56 0.5
57 0.48
58 0.4
59 0.34
60 0.24
61 0.16
62 0.16
63 0.15
64 0.15
65 0.09
66 0.11
67 0.12
68 0.16
69 0.16
70 0.19
71 0.2
72 0.21
73 0.2
74 0.19
75 0.22
76 0.18
77 0.19
78 0.16
79 0.16
80 0.15
81 0.14
82 0.15
83 0.12
84 0.12
85 0.15
86 0.17
87 0.19
88 0.2
89 0.19
90 0.2
91 0.2
92 0.19
93 0.16
94 0.15
95 0.12
96 0.11
97 0.11
98 0.08
99 0.08
100 0.08
101 0.08
102 0.07
103 0.06
104 0.06
105 0.05
106 0.05
107 0.05
108 0.07
109 0.06
110 0.06
111 0.06
112 0.08
113 0.08
114 0.1
115 0.1
116 0.09
117 0.1
118 0.12
119 0.16
120 0.18
121 0.21
122 0.26
123 0.32
124 0.39
125 0.45
126 0.5
127 0.51
128 0.51
129 0.54
130 0.49
131 0.47
132 0.42
133 0.39
134 0.33
135 0.29
136 0.26
137 0.21
138 0.18
139 0.13
140 0.11
141 0.07
142 0.07
143 0.07
144 0.07
145 0.07
146 0.09
147 0.13
148 0.15
149 0.18
150 0.19
151 0.24
152 0.24
153 0.24
154 0.24
155 0.19
156 0.19
157 0.2
158 0.18
159 0.12
160 0.12
161 0.12
162 0.12
163 0.12
164 0.11
165 0.07
166 0.08
167 0.09
168 0.13
169 0.14
170 0.13
171 0.14
172 0.14
173 0.15
174 0.22
175 0.27
176 0.24
177 0.32
178 0.31
179 0.32
180 0.34
181 0.4
182 0.35
183 0.33
184 0.32
185 0.26
186 0.31
187 0.29
188 0.26
189 0.25
190 0.23
191 0.21
192 0.24
193 0.22
194 0.18
195 0.18
196 0.19
197 0.19
198 0.24
199 0.24
200 0.21
201 0.22
202 0.21
203 0.22
204 0.2
205 0.16
206 0.17
207 0.2
208 0.26
209 0.25
210 0.3
211 0.31
212 0.31
213 0.31
214 0.26
215 0.24
216 0.2
217 0.19
218 0.21
219 0.21
220 0.23
221 0.23
222 0.21
223 0.2
224 0.2
225 0.21
226 0.17
227 0.19
228 0.19
229 0.19
230 0.18
231 0.17
232 0.15
233 0.14
234 0.14
235 0.11
236 0.09
237 0.1
238 0.11
239 0.18
240 0.22
241 0.27
242 0.27
243 0.29
244 0.35
245 0.34
246 0.38
247 0.39
248 0.43
249 0.44
250 0.47
251 0.44
252 0.4
253 0.42
254 0.37
255 0.32
256 0.27
257 0.22
258 0.18
259 0.18
260 0.18
261 0.15
262 0.17
263 0.16
264 0.15
265 0.15
266 0.14
267 0.13
268 0.14
269 0.15
270 0.13
271 0.14
272 0.13
273 0.14
274 0.14
275 0.18
276 0.17
277 0.16