Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317T072

Protein Details
Accession A0A317T072    Localization Confidence Low Confidence Score 5.7
NoLS Segment(s)
PositionSequenceProtein Nature
156-179DTFTGVRKYRKWREKMEGERWRGVHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 20, mito 3, nucl 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
Amino Acid Sequences MELLIGGYSYGSLIASLTPPIPDILKLLETPPPSSAPAFAKSLLTAKESASRWLDTHPSTRTSYSGTFNRAAVHAALQQEENRKLECQQAHHGVDKRWRVTARYLLVSPLLPPISTLLMGFTGVKVWSLGRGSVDEGEKGIEAVGARVLAVYGDGDTFTGVRKYRKWREKMEGERWRGVEVGGAGHFWREGGVMEVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.06
3 0.07
4 0.08
5 0.08
6 0.09
7 0.1
8 0.1
9 0.1
10 0.11
11 0.12
12 0.13
13 0.14
14 0.15
15 0.18
16 0.19
17 0.2
18 0.21
19 0.2
20 0.21
21 0.2
22 0.23
23 0.21
24 0.22
25 0.23
26 0.21
27 0.2
28 0.19
29 0.22
30 0.2
31 0.18
32 0.16
33 0.16
34 0.22
35 0.22
36 0.25
37 0.24
38 0.24
39 0.23
40 0.25
41 0.28
42 0.24
43 0.28
44 0.27
45 0.27
46 0.28
47 0.29
48 0.27
49 0.26
50 0.26
51 0.27
52 0.28
53 0.28
54 0.27
55 0.27
56 0.27
57 0.23
58 0.22
59 0.16
60 0.14
61 0.13
62 0.12
63 0.12
64 0.12
65 0.14
66 0.17
67 0.2
68 0.19
69 0.18
70 0.18
71 0.18
72 0.23
73 0.23
74 0.22
75 0.25
76 0.3
77 0.31
78 0.36
79 0.37
80 0.34
81 0.39
82 0.39
83 0.35
84 0.32
85 0.31
86 0.28
87 0.29
88 0.32
89 0.28
90 0.26
91 0.25
92 0.22
93 0.22
94 0.2
95 0.17
96 0.13
97 0.1
98 0.08
99 0.08
100 0.08
101 0.08
102 0.08
103 0.08
104 0.06
105 0.06
106 0.06
107 0.06
108 0.05
109 0.05
110 0.05
111 0.05
112 0.05
113 0.05
114 0.07
115 0.08
116 0.08
117 0.08
118 0.09
119 0.1
120 0.13
121 0.14
122 0.11
123 0.11
124 0.11
125 0.1
126 0.09
127 0.08
128 0.06
129 0.05
130 0.05
131 0.06
132 0.05
133 0.05
134 0.05
135 0.05
136 0.04
137 0.04
138 0.04
139 0.03
140 0.04
141 0.04
142 0.04
143 0.05
144 0.05
145 0.06
146 0.1
147 0.13
148 0.17
149 0.24
150 0.34
151 0.45
152 0.55
153 0.62
154 0.67
155 0.74
156 0.81
157 0.84
158 0.85
159 0.84
160 0.81
161 0.79
162 0.71
163 0.62
164 0.51
165 0.41
166 0.33
167 0.23
168 0.2
169 0.14
170 0.14
171 0.13
172 0.13
173 0.13
174 0.09
175 0.09
176 0.07
177 0.07