Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317T2W3

Protein Details
Accession A0A317T2W3    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
2-30APAAAQGGKKQKKKWSKGKVKDKAQHAVVHydrophilic
NLS Segment(s)
PositionSequence
9-24GKKQKKKWSKGKVKDK
Subcellular Location(s) cyto 12.5, cyto_nucl 11.833, nucl 10, mito_nucl 7.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR004977  Ribosomal_S25  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF03297  Ribosomal_S25  
Amino Acid Sequences MAPAAAQGGKKQKKKWSKGKVKDKAQHAVVADKTIQDRLNKDVQTYRLITVAVLVDRLKINGSLARKALAELEAKGVIKKVVGHSKLSIYTRAVAAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.82
4 0.84
5 0.88
6 0.93
7 0.93
8 0.92
9 0.89
10 0.85
11 0.81
12 0.72
13 0.65
14 0.55
15 0.5
16 0.39
17 0.34
18 0.27
19 0.21
20 0.2
21 0.19
22 0.2
23 0.17
24 0.18
25 0.2
26 0.26
27 0.25
28 0.26
29 0.27
30 0.27
31 0.28
32 0.27
33 0.24
34 0.18
35 0.18
36 0.16
37 0.13
38 0.11
39 0.08
40 0.07
41 0.06
42 0.07
43 0.07
44 0.08
45 0.07
46 0.07
47 0.08
48 0.1
49 0.13
50 0.14
51 0.15
52 0.16
53 0.15
54 0.16
55 0.16
56 0.15
57 0.14
58 0.12
59 0.14
60 0.14
61 0.15
62 0.15
63 0.14
64 0.12
65 0.12
66 0.14
67 0.18
68 0.26
69 0.28
70 0.31
71 0.32
72 0.36
73 0.41
74 0.41
75 0.37
76 0.3
77 0.3
78 0.28