Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SV23

Protein Details
Accession A0A317SV23    Localization Confidence Medium Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
31-58LEEERKKARERIRRKREKEKEIRKLVASBasic
NLS Segment(s)
PositionSequence
7-54RKGEWYRPRIEGGGGRLAGSSKERLEEERKKARERIRRKREKEKEIRK
Subcellular Location(s) nucl 17, mito 7, cyto 2
Family & Domain DBs
Amino Acid Sequences MKKGEERKGEWYRPRIEGGGGRLAGSSKERLEEERKKARERIRRKREKEKEIRKLVASGMGPIASRIMDGDQRERRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.52
3 0.46
4 0.41
5 0.36
6 0.34
7 0.29
8 0.26
9 0.23
10 0.22
11 0.2
12 0.18
13 0.16
14 0.11
15 0.12
16 0.13
17 0.17
18 0.25
19 0.32
20 0.38
21 0.45
22 0.49
23 0.51
24 0.56
25 0.61
26 0.63
27 0.66
28 0.69
29 0.71
30 0.78
31 0.83
32 0.87
33 0.89
34 0.9
35 0.9
36 0.9
37 0.89
38 0.86
39 0.82
40 0.72
41 0.63
42 0.53
43 0.47
44 0.37
45 0.27
46 0.2
47 0.17
48 0.15
49 0.14
50 0.14
51 0.08
52 0.08
53 0.07
54 0.09
55 0.13
56 0.16
57 0.25