Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SD12

Protein Details
Accession A0A317SD12   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
84-107KDKTTTFLKAKKKHLKEAKKAAGLHydrophilic
NLS Segment(s)
PositionSequence
92-105KAKKKHLKEAKKAA
Subcellular Location(s) cyto 26.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR015324  Ribosomal_Rsm22-like  
Gene Ontology GO:0005739  C:mitochondrion  
GO:0008168  F:methyltransferase activity  
GO:0032259  P:methylation  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF09243  Rsm22  
Amino Acid Sequences MLPPIKHDSHIILDLCTATGSIERWVVPQSLGKLEYRDAKKGGWGDLWALGAKARTSQDIKIGGSSRKAMSKFVTINGVRAIVKDKTTTFLKAKKKHLKEAKKAAGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.2
3 0.16
4 0.12
5 0.07
6 0.07
7 0.08
8 0.08
9 0.1
10 0.1
11 0.11
12 0.13
13 0.13
14 0.13
15 0.15
16 0.15
17 0.17
18 0.18
19 0.18
20 0.17
21 0.19
22 0.26
23 0.26
24 0.28
25 0.26
26 0.25
27 0.27
28 0.28
29 0.27
30 0.19
31 0.17
32 0.14
33 0.14
34 0.15
35 0.11
36 0.09
37 0.08
38 0.08
39 0.07
40 0.08
41 0.08
42 0.1
43 0.11
44 0.12
45 0.16
46 0.18
47 0.18
48 0.19
49 0.21
50 0.2
51 0.2
52 0.21
53 0.19
54 0.21
55 0.22
56 0.21
57 0.2
58 0.25
59 0.24
60 0.24
61 0.3
62 0.26
63 0.27
64 0.26
65 0.26
66 0.2
67 0.19
68 0.22
69 0.16
70 0.17
71 0.18
72 0.18
73 0.21
74 0.23
75 0.28
76 0.31
77 0.37
78 0.46
79 0.52
80 0.62
81 0.68
82 0.73
83 0.78
84 0.83
85 0.85
86 0.86
87 0.89