Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317T0J8

Protein Details
Accession A0A317T0J8    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
54-93RIKGQSIEEEKKRRRRRRKTQSTRSRKKKRARRTKRKGNRBasic
NLS Segment(s)
PositionSequence
63-93EKKRRRRRRKTQSTRSRKKKRARRTKRKGNR
Subcellular Location(s) mito 12.5, mito_nucl 11.833, nucl 10, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences MVRGLVAVVGAYAAGEGEEGRRRGGKDELGCDVWRPNDQQLDDRVGSQANEGGRIKGQSIEEEKKRRRRRRKTQSTRSRKKKRARRTKRKGNR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.03
3 0.03
4 0.06
5 0.11
6 0.12
7 0.14
8 0.17
9 0.18
10 0.21
11 0.25
12 0.28
13 0.27
14 0.3
15 0.32
16 0.32
17 0.31
18 0.29
19 0.27
20 0.22
21 0.2
22 0.19
23 0.18
24 0.2
25 0.21
26 0.23
27 0.23
28 0.26
29 0.25
30 0.23
31 0.21
32 0.17
33 0.16
34 0.13
35 0.13
36 0.07
37 0.11
38 0.11
39 0.11
40 0.11
41 0.12
42 0.12
43 0.13
44 0.13
45 0.13
46 0.19
47 0.26
48 0.33
49 0.42
50 0.5
51 0.58
52 0.69
53 0.76
54 0.81
55 0.86
56 0.9
57 0.92
58 0.95
59 0.96
60 0.96
61 0.97
62 0.97
63 0.97
64 0.97
65 0.96
66 0.95
67 0.94
68 0.93
69 0.93
70 0.93
71 0.94
72 0.94
73 0.94