Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317T1C2

Protein Details
Accession A0A317T1C2   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPKRPRRLRRPSPDALQPLKBasic
NLS Segment(s)
PositionSequence
5-7PRR
Subcellular Location(s) plas 19, mito 5, E.R. 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR019185  Integral_membrane_SYS1-rel  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF09801  SYS1  
Amino Acid Sequences MPKRPRRLRRPSPDALQPLKTFLQILLLQTIYYISSSILILFTALVAGCAFSLDLIFSWRSVRGDNTVGWTLGVVWLLCSGIMVIAQLLVHARSKMVLDFSLTLHFLHLLVVTGYEWELPKSVLWWGLQVASVALMVGVGTWACRWRELRPIPFGSGRVGGGIAGAGDSGGAYEMVRMKEEEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.75
3 0.7
4 0.6
5 0.55
6 0.48
7 0.42
8 0.33
9 0.24
10 0.24
11 0.2
12 0.2
13 0.18
14 0.17
15 0.16
16 0.15
17 0.16
18 0.1
19 0.09
20 0.08
21 0.05
22 0.06
23 0.06
24 0.06
25 0.06
26 0.06
27 0.06
28 0.05
29 0.05
30 0.04
31 0.04
32 0.04
33 0.04
34 0.04
35 0.04
36 0.04
37 0.04
38 0.03
39 0.03
40 0.03
41 0.03
42 0.06
43 0.06
44 0.06
45 0.08
46 0.09
47 0.1
48 0.11
49 0.13
50 0.14
51 0.16
52 0.16
53 0.19
54 0.18
55 0.18
56 0.16
57 0.15
58 0.11
59 0.1
60 0.1
61 0.05
62 0.04
63 0.04
64 0.04
65 0.04
66 0.04
67 0.03
68 0.03
69 0.03
70 0.03
71 0.02
72 0.02
73 0.02
74 0.03
75 0.03
76 0.04
77 0.04
78 0.04
79 0.04
80 0.05
81 0.05
82 0.06
83 0.07
84 0.06
85 0.07
86 0.08
87 0.08
88 0.09
89 0.09
90 0.09
91 0.08
92 0.08
93 0.07
94 0.06
95 0.06
96 0.05
97 0.04
98 0.04
99 0.04
100 0.04
101 0.04
102 0.05
103 0.05
104 0.05
105 0.06
106 0.06
107 0.06
108 0.07
109 0.08
110 0.09
111 0.09
112 0.1
113 0.1
114 0.1
115 0.1
116 0.1
117 0.09
118 0.06
119 0.06
120 0.05
121 0.04
122 0.03
123 0.03
124 0.02
125 0.03
126 0.02
127 0.03
128 0.04
129 0.07
130 0.08
131 0.12
132 0.14
133 0.17
134 0.28
135 0.36
136 0.42
137 0.46
138 0.49
139 0.5
140 0.51
141 0.49
142 0.42
143 0.35
144 0.29
145 0.22
146 0.18
147 0.14
148 0.11
149 0.1
150 0.06
151 0.04
152 0.04
153 0.03
154 0.03
155 0.03
156 0.03
157 0.03
158 0.03
159 0.03
160 0.06
161 0.11
162 0.12
163 0.14