Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SPK5

Protein Details
Accession A0A317SPK5    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
103-125PPSSRPPSRSHTQKRLRAKRAAEHydrophilic
NLS Segment(s)
PositionSequence
113-124HTQKRLRAKRAA
Subcellular Location(s) nucl 11, cyto_nucl 10, mito 8, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR036249  Thioredoxin-like_sf  
Amino Acid Sequences MGLQYDSPLLVSSPRINQPILQHPIPHRTLVRGLTTFTDKSTTYTFFPLVPCPESLFLQTSLLPMSYQPPQLLPPQPSPSPPLFGTSPSKKRSPQIAFAEDTPPSSRPPSRSHTQKRLRAKRAAERPGWVSGKDDSIGLDARVEAVVVDVLWPGAESLDCGRRVGDLRGSRGFTVLCFLGCTIEHLQGLGQVASLLGNLNADVFGVSLSAPPPHTASLPIIHDRTRALTLSLGLLHPLGGGRQALDAIVILDRDSRQRVVLPVGWGPRPVPGQCAADEESNSINSIVGRCVKGVEWLCNEALDDTVEDVEMGMMDNEIVMAAL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.3
3 0.3
4 0.34
5 0.39
6 0.45
7 0.48
8 0.43
9 0.44
10 0.46
11 0.53
12 0.52
13 0.5
14 0.42
15 0.39
16 0.42
17 0.4
18 0.41
19 0.34
20 0.34
21 0.32
22 0.36
23 0.32
24 0.28
25 0.27
26 0.21
27 0.23
28 0.26
29 0.24
30 0.22
31 0.24
32 0.24
33 0.23
34 0.25
35 0.26
36 0.26
37 0.26
38 0.24
39 0.24
40 0.24
41 0.23
42 0.24
43 0.22
44 0.19
45 0.19
46 0.18
47 0.16
48 0.15
49 0.14
50 0.12
51 0.09
52 0.12
53 0.14
54 0.15
55 0.15
56 0.16
57 0.18
58 0.24
59 0.29
60 0.3
61 0.32
62 0.36
63 0.37
64 0.37
65 0.4
66 0.36
67 0.34
68 0.3
69 0.28
70 0.23
71 0.26
72 0.32
73 0.36
74 0.43
75 0.43
76 0.47
77 0.47
78 0.51
79 0.58
80 0.55
81 0.55
82 0.55
83 0.55
84 0.52
85 0.5
86 0.48
87 0.38
88 0.34
89 0.27
90 0.2
91 0.17
92 0.2
93 0.22
94 0.23
95 0.28
96 0.33
97 0.4
98 0.5
99 0.57
100 0.64
101 0.7
102 0.75
103 0.8
104 0.84
105 0.84
106 0.8
107 0.78
108 0.76
109 0.76
110 0.75
111 0.66
112 0.59
113 0.54
114 0.53
115 0.47
116 0.38
117 0.3
118 0.23
119 0.22
120 0.19
121 0.17
122 0.1
123 0.1
124 0.11
125 0.08
126 0.08
127 0.06
128 0.06
129 0.06
130 0.05
131 0.04
132 0.03
133 0.03
134 0.03
135 0.03
136 0.03
137 0.03
138 0.03
139 0.03
140 0.02
141 0.03
142 0.03
143 0.03
144 0.05
145 0.09
146 0.09
147 0.09
148 0.1
149 0.11
150 0.12
151 0.13
152 0.18
153 0.17
154 0.21
155 0.23
156 0.24
157 0.23
158 0.22
159 0.21
160 0.15
161 0.14
162 0.1
163 0.07
164 0.07
165 0.06
166 0.06
167 0.06
168 0.1
169 0.09
170 0.11
171 0.11
172 0.1
173 0.1
174 0.11
175 0.11
176 0.08
177 0.06
178 0.05
179 0.05
180 0.05
181 0.05
182 0.04
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.03
191 0.03
192 0.03
193 0.03
194 0.04
195 0.04
196 0.06
197 0.06
198 0.07
199 0.09
200 0.09
201 0.1
202 0.11
203 0.12
204 0.15
205 0.17
206 0.2
207 0.21
208 0.2
209 0.21
210 0.2
211 0.21
212 0.19
213 0.17
214 0.14
215 0.13
216 0.13
217 0.13
218 0.14
219 0.11
220 0.09
221 0.09
222 0.08
223 0.07
224 0.06
225 0.05
226 0.06
227 0.06
228 0.06
229 0.06
230 0.06
231 0.06
232 0.06
233 0.06
234 0.05
235 0.06
236 0.05
237 0.05
238 0.07
239 0.08
240 0.11
241 0.14
242 0.14
243 0.15
244 0.17
245 0.19
246 0.22
247 0.25
248 0.25
249 0.27
250 0.3
251 0.3
252 0.28
253 0.27
254 0.26
255 0.27
256 0.24
257 0.23
258 0.24
259 0.25
260 0.25
261 0.29
262 0.27
263 0.25
264 0.25
265 0.24
266 0.21
267 0.19
268 0.19
269 0.15
270 0.13
271 0.12
272 0.12
273 0.14
274 0.17
275 0.17
276 0.17
277 0.18
278 0.18
279 0.25
280 0.27
281 0.3
282 0.3
283 0.32
284 0.32
285 0.31
286 0.31
287 0.23
288 0.21
289 0.15
290 0.12
291 0.1
292 0.09
293 0.09
294 0.08
295 0.08
296 0.07
297 0.06
298 0.06
299 0.05
300 0.05
301 0.04
302 0.04
303 0.04