Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SJU4

Protein Details
Accession A0A317SJU4    Localization Confidence High Confidence Score 15.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MSGRAGGKQKPLKQPKKTKKEDDEEDKABasic
NLS Segment(s)
PositionSequence
5-64AGGKQKPLKQPKKTKKEDDEEDKAFKEKQRKAAAEEKAMAEKARGRGPLATGGIKKSGKK
Subcellular Location(s) nucl 20, cyto 4, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR015157  TMA7  
Pfam View protein in Pfam  
PF09072  TMA7  
Amino Acid Sequences MSGRAGGKQKPLKQPKKTKKEDDEEDKAFKEKQRKAAAEEKAMAEKARGRGPLATGGIKKSGKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.89
4 0.91
5 0.9
6 0.88
7 0.87
8 0.86
9 0.83
10 0.8
11 0.72
12 0.65
13 0.56
14 0.48
15 0.41
16 0.35
17 0.36
18 0.32
19 0.37
20 0.43
21 0.43
22 0.47
23 0.53
24 0.53
25 0.48
26 0.46
27 0.39
28 0.33
29 0.32
30 0.26
31 0.2
32 0.2
33 0.2
34 0.22
35 0.22
36 0.22
37 0.23
38 0.25
39 0.29
40 0.28
41 0.3
42 0.28
43 0.29
44 0.34