Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SY32

Protein Details
Accession A0A317SY32    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
52-72KEENNFACTRKKKKAKPCNKIHydrophilic
NLS Segment(s)
PositionSequence
62-67KKKKAK
Subcellular Location(s) nucl 17, cyto_nucl 10, mito 9
Family & Domain DBs
Amino Acid Sequences MRGASNSSSSSSSSRKVVIVGNCESDNNKQAYKATKRARLEQPINGYHNEDKEENNFACTRKKKKAKPCNKI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.24
4 0.27
5 0.26
6 0.28
7 0.27
8 0.28
9 0.26
10 0.26
11 0.27
12 0.23
13 0.24
14 0.21
15 0.19
16 0.17
17 0.19
18 0.27
19 0.3
20 0.37
21 0.4
22 0.45
23 0.47
24 0.54
25 0.58
26 0.59
27 0.57
28 0.53
29 0.52
30 0.49
31 0.49
32 0.43
33 0.39
34 0.32
35 0.3
36 0.28
37 0.23
38 0.2
39 0.21
40 0.25
41 0.22
42 0.23
43 0.24
44 0.23
45 0.32
46 0.39
47 0.45
48 0.5
49 0.61
50 0.67
51 0.76
52 0.86