Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SDQ2

Protein Details
Accession A0A317SDQ2    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
52-85VNMLQEKKRSNERPNKRKNSRKKAPPSQPNPSEAHydrophilic
NLS Segment(s)
PositionSequence
58-76KKRSNERPNKRKNSRKKAP
Subcellular Location(s) nucl 17.5, cyto_nucl 11, mito 5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MTAVPTLSMTKCEAPFTPNSKTLNIRLSRGWFARIGHTSSSLTYPIHASRTVNMLQEKKRSNERPNKRKNSRKKAPPSQPNPSEAGPSTAASSSVQGSFTPSNIGARPEQTSLGGNCNTAHESNYVLSTPHDSRPRIYAPQALPCYPRTVRAPSVAMTSRAKTGLINVRFQDRRRGMVHSPPRLAAGTIPDGGVDSKGIMPGRFLDDSEGEDTDEPEPPTNTMVDRSERIGAGDHQTSPRPTSFSRPIPQRPYTAPPHHRDYIT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.34
3 0.37
4 0.4
5 0.41
6 0.43
7 0.44
8 0.47
9 0.49
10 0.5
11 0.47
12 0.44
13 0.43
14 0.45
15 0.47
16 0.44
17 0.42
18 0.35
19 0.34
20 0.38
21 0.37
22 0.35
23 0.3
24 0.31
25 0.29
26 0.27
27 0.28
28 0.22
29 0.18
30 0.16
31 0.18
32 0.17
33 0.19
34 0.19
35 0.18
36 0.18
37 0.23
38 0.24
39 0.25
40 0.29
41 0.33
42 0.36
43 0.43
44 0.46
45 0.46
46 0.54
47 0.58
48 0.63
49 0.67
50 0.74
51 0.77
52 0.83
53 0.9
54 0.9
55 0.92
56 0.93
57 0.94
58 0.93
59 0.93
60 0.92
61 0.92
62 0.92
63 0.92
64 0.89
65 0.88
66 0.81
67 0.74
68 0.66
69 0.56
70 0.48
71 0.38
72 0.33
73 0.24
74 0.2
75 0.18
76 0.15
77 0.14
78 0.12
79 0.12
80 0.1
81 0.09
82 0.09
83 0.08
84 0.12
85 0.11
86 0.11
87 0.12
88 0.11
89 0.12
90 0.13
91 0.15
92 0.12
93 0.13
94 0.15
95 0.14
96 0.15
97 0.13
98 0.15
99 0.14
100 0.16
101 0.15
102 0.14
103 0.13
104 0.14
105 0.14
106 0.12
107 0.13
108 0.09
109 0.1
110 0.1
111 0.1
112 0.09
113 0.08
114 0.08
115 0.11
116 0.12
117 0.16
118 0.21
119 0.21
120 0.21
121 0.25
122 0.28
123 0.27
124 0.26
125 0.28
126 0.25
127 0.32
128 0.33
129 0.3
130 0.29
131 0.27
132 0.31
133 0.25
134 0.27
135 0.22
136 0.25
137 0.26
138 0.27
139 0.28
140 0.23
141 0.27
142 0.25
143 0.25
144 0.22
145 0.21
146 0.19
147 0.18
148 0.18
149 0.13
150 0.17
151 0.23
152 0.23
153 0.26
154 0.25
155 0.32
156 0.36
157 0.37
158 0.42
159 0.35
160 0.37
161 0.36
162 0.41
163 0.36
164 0.43
165 0.51
166 0.48
167 0.47
168 0.43
169 0.43
170 0.38
171 0.35
172 0.26
173 0.2
174 0.16
175 0.15
176 0.14
177 0.12
178 0.12
179 0.12
180 0.11
181 0.08
182 0.06
183 0.06
184 0.09
185 0.1
186 0.1
187 0.1
188 0.12
189 0.16
190 0.15
191 0.15
192 0.15
193 0.15
194 0.18
195 0.19
196 0.18
197 0.14
198 0.14
199 0.15
200 0.14
201 0.16
202 0.15
203 0.15
204 0.15
205 0.15
206 0.16
207 0.16
208 0.16
209 0.16
210 0.19
211 0.2
212 0.21
213 0.24
214 0.25
215 0.24
216 0.24
217 0.23
218 0.22
219 0.23
220 0.24
221 0.24
222 0.24
223 0.29
224 0.3
225 0.31
226 0.3
227 0.3
228 0.29
229 0.35
230 0.41
231 0.46
232 0.53
233 0.59
234 0.66
235 0.7
236 0.72
237 0.69
238 0.66
239 0.65
240 0.66
241 0.67
242 0.67
243 0.65
244 0.68