Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SG12

Protein Details
Accession A0A317SG12    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-42GALQQIRGKKRTRKEPTIKVQLMRHydrophilic
NLS Segment(s)
PositionSequence
26-32GKKRTRK
103-105KKK
Subcellular Location(s) mito 14, nucl 8.5, cyto_nucl 8, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000244  Ribosomal_L9  
IPR020070  Ribosomal_L9_N  
IPR036935  Ribosomal_L9_N_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01281  Ribosomal_L9_N  
Amino Acid Sequences MGFFSISSCPTCIRRLAGGALQQIRGKKRTRKEPTIKVQLMRDVPKFGQKGTVLQIQRGRMRVVFRFPKGIADYVTRHMLKSMPAGTLKHRDPMFMNARVEKKKKHKVAIELLTPTQTIALLDSFIPPNLMFSRPTIAPNEPAIHGSVTLTDIATAVRNIAAVSGGEGSRVVIGPENIRFPGKGVEGDKLKSLGTFDFEINVKGAIDFVRRRVMVVKQEEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.28
3 0.31
4 0.31
5 0.33
6 0.37
7 0.37
8 0.36
9 0.36
10 0.39
11 0.41
12 0.43
13 0.46
14 0.48
15 0.55
16 0.64
17 0.71
18 0.77
19 0.82
20 0.86
21 0.88
22 0.9
23 0.85
24 0.78
25 0.71
26 0.67
27 0.62
28 0.58
29 0.49
30 0.42
31 0.39
32 0.42
33 0.39
34 0.33
35 0.34
36 0.29
37 0.3
38 0.3
39 0.36
40 0.29
41 0.33
42 0.37
43 0.36
44 0.38
45 0.37
46 0.34
47 0.3
48 0.33
49 0.32
50 0.37
51 0.38
52 0.37
53 0.39
54 0.38
55 0.4
56 0.38
57 0.36
58 0.29
59 0.25
60 0.26
61 0.24
62 0.29
63 0.25
64 0.22
65 0.22
66 0.21
67 0.18
68 0.2
69 0.18
70 0.15
71 0.16
72 0.17
73 0.2
74 0.26
75 0.26
76 0.28
77 0.26
78 0.25
79 0.25
80 0.32
81 0.34
82 0.32
83 0.33
84 0.31
85 0.37
86 0.42
87 0.43
88 0.43
89 0.47
90 0.52
91 0.57
92 0.59
93 0.59
94 0.6
95 0.66
96 0.63
97 0.56
98 0.48
99 0.42
100 0.36
101 0.31
102 0.23
103 0.14
104 0.09
105 0.06
106 0.05
107 0.04
108 0.04
109 0.05
110 0.06
111 0.06
112 0.06
113 0.07
114 0.06
115 0.08
116 0.09
117 0.1
118 0.09
119 0.1
120 0.13
121 0.14
122 0.15
123 0.17
124 0.16
125 0.18
126 0.19
127 0.2
128 0.18
129 0.17
130 0.17
131 0.14
132 0.13
133 0.1
134 0.08
135 0.07
136 0.07
137 0.06
138 0.05
139 0.05
140 0.06
141 0.06
142 0.06
143 0.05
144 0.05
145 0.05
146 0.05
147 0.05
148 0.05
149 0.04
150 0.05
151 0.07
152 0.06
153 0.06
154 0.06
155 0.07
156 0.07
157 0.07
158 0.07
159 0.07
160 0.08
161 0.11
162 0.13
163 0.16
164 0.16
165 0.17
166 0.17
167 0.16
168 0.2
169 0.18
170 0.21
171 0.21
172 0.26
173 0.29
174 0.3
175 0.3
176 0.27
177 0.25
178 0.21
179 0.21
180 0.16
181 0.16
182 0.17
183 0.15
184 0.17
185 0.18
186 0.18
187 0.17
188 0.17
189 0.13
190 0.11
191 0.12
192 0.1
193 0.17
194 0.18
195 0.21
196 0.29
197 0.28
198 0.3
199 0.34
200 0.39
201 0.42