Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SX41

Protein Details
Accession A0A317SX41   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
51-75RGKTVASKAQRKKDRNKSYARGRVEHydrophilic
NLS Segment(s)
PositionSequence
13-20HKARARSR
56-68ASKAQRKKDRNKS
Subcellular Location(s) mito 15, nucl 10.5, cyto_nucl 6.5
Family & Domain DBs
Amino Acid Sequences MPSRNNPNLPSRHKARARSRPSSSSHKFRIAATRTSPLDPVLKSSGLGVSRGKTVASKAQRKKDRNKSYARGRVEMEKELERASKAGEVVMRDASELPVSRRQAKLAARAAAVREANAKKGQEEEEEEEEEVAGDAARPEMDVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.75
3 0.77
4 0.79
5 0.8
6 0.8
7 0.76
8 0.75
9 0.76
10 0.73
11 0.71
12 0.68
13 0.66
14 0.6
15 0.56
16 0.6
17 0.54
18 0.51
19 0.46
20 0.47
21 0.42
22 0.42
23 0.4
24 0.32
25 0.31
26 0.25
27 0.26
28 0.22
29 0.19
30 0.18
31 0.18
32 0.19
33 0.15
34 0.17
35 0.14
36 0.13
37 0.14
38 0.14
39 0.13
40 0.11
41 0.12
42 0.18
43 0.26
44 0.34
45 0.41
46 0.5
47 0.59
48 0.66
49 0.75
50 0.78
51 0.8
52 0.78
53 0.8
54 0.79
55 0.8
56 0.81
57 0.73
58 0.64
59 0.55
60 0.53
61 0.47
62 0.4
63 0.32
64 0.25
65 0.23
66 0.21
67 0.21
68 0.15
69 0.13
70 0.11
71 0.1
72 0.09
73 0.09
74 0.1
75 0.1
76 0.11
77 0.11
78 0.11
79 0.1
80 0.1
81 0.09
82 0.1
83 0.1
84 0.12
85 0.17
86 0.2
87 0.24
88 0.25
89 0.26
90 0.3
91 0.33
92 0.39
93 0.38
94 0.38
95 0.35
96 0.35
97 0.35
98 0.34
99 0.3
100 0.23
101 0.24
102 0.23
103 0.26
104 0.29
105 0.28
106 0.24
107 0.27
108 0.29
109 0.25
110 0.3
111 0.32
112 0.31
113 0.32
114 0.32
115 0.28
116 0.26
117 0.22
118 0.16
119 0.11
120 0.07
121 0.05
122 0.05
123 0.06
124 0.06