Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SII2

Protein Details
Accession A0A317SII2    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
8-42IPLPTFCTSNRRKQPRYHRSHKNKNRISPNLPPKAHydrophilic
NLS Segment(s)
PositionSequence
25-29HRSHK
Subcellular Location(s) mito 24.5, cyto_mito 13.5
Family & Domain DBs
Amino Acid Sequences MATKSSRIPLPTFCTSNRRKQPRYHRSHKNKNRISPNLPPKAWEILIQSRQTARQDRVWENEEQERIRAFEAAREEHESLSVHFLFESGNQGHEAVNTRFSGDGIADHTSVLLRRGVEGQCQIALLGAATLRNPSLSGVSLAEITVVKGGGG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.48
2 0.51
3 0.59
4 0.64
5 0.67
6 0.67
7 0.73
8 0.81
9 0.82
10 0.86
11 0.86
12 0.87
13 0.88
14 0.93
15 0.93
16 0.93
17 0.91
18 0.9
19 0.9
20 0.87
21 0.82
22 0.81
23 0.81
24 0.78
25 0.69
26 0.62
27 0.54
28 0.5
29 0.44
30 0.36
31 0.31
32 0.3
33 0.35
34 0.34
35 0.32
36 0.29
37 0.32
38 0.34
39 0.35
40 0.3
41 0.3
42 0.35
43 0.37
44 0.41
45 0.41
46 0.37
47 0.35
48 0.36
49 0.34
50 0.28
51 0.26
52 0.21
53 0.19
54 0.18
55 0.16
56 0.12
57 0.12
58 0.14
59 0.14
60 0.15
61 0.18
62 0.18
63 0.16
64 0.17
65 0.15
66 0.12
67 0.14
68 0.13
69 0.09
70 0.08
71 0.08
72 0.08
73 0.08
74 0.11
75 0.08
76 0.09
77 0.09
78 0.1
79 0.1
80 0.11
81 0.15
82 0.11
83 0.13
84 0.13
85 0.13
86 0.13
87 0.13
88 0.12
89 0.08
90 0.08
91 0.08
92 0.1
93 0.09
94 0.09
95 0.09
96 0.09
97 0.1
98 0.1
99 0.1
100 0.08
101 0.09
102 0.14
103 0.15
104 0.18
105 0.19
106 0.19
107 0.18
108 0.18
109 0.16
110 0.12
111 0.11
112 0.07
113 0.06
114 0.05
115 0.05
116 0.05
117 0.06
118 0.06
119 0.07
120 0.07
121 0.08
122 0.09
123 0.1
124 0.11
125 0.11
126 0.12
127 0.12
128 0.12
129 0.12
130 0.1
131 0.09
132 0.09