Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SHB2

Protein Details
Accession A0A317SHB2    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
32-51TEKWKRWEERVEKQRNREELBasic
63-93KGKIEECRERRKWKWKNKKCFKWVKGDRDLVBasic
NLS Segment(s)
PositionSequence
72-80RRKWKWKNK
Subcellular Location(s) cyto_nucl 12, nucl 11.5, cyto 9.5, mito 5
Family & Domain DBs
Amino Acid Sequences MEVRVCGWRVEKEEEKKGRVDWERFKAELKITEKWKRWEERVEKQRNREELEKLIEEVEGWIKGKIEECRERRKWKWKNKKCFKWVKGDRDLVQNLPEIEWEEGKRVVGEEEKGREMIRGLGKREEREQEREGFWERVELEEEEVEECLKKQGNRKAAGEDEIGGKVWKEIWEEGKGRKVITGLLKWSLEIGYVPKQFRRALGVVIRKLRKEDYGKLERTIWGEKRE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.61
3 0.59
4 0.56
5 0.58
6 0.57
7 0.58
8 0.57
9 0.59
10 0.61
11 0.59
12 0.6
13 0.54
14 0.5
15 0.49
16 0.45
17 0.43
18 0.47
19 0.55
20 0.59
21 0.62
22 0.66
23 0.65
24 0.66
25 0.69
26 0.69
27 0.71
28 0.75
29 0.79
30 0.77
31 0.79
32 0.82
33 0.77
34 0.74
35 0.68
36 0.61
37 0.56
38 0.54
39 0.47
40 0.39
41 0.33
42 0.27
43 0.22
44 0.19
45 0.15
46 0.1
47 0.1
48 0.09
49 0.09
50 0.1
51 0.14
52 0.17
53 0.23
54 0.31
55 0.37
56 0.47
57 0.54
58 0.62
59 0.67
60 0.74
61 0.77
62 0.79
63 0.85
64 0.85
65 0.88
66 0.91
67 0.93
68 0.92
69 0.93
70 0.87
71 0.86
72 0.85
73 0.83
74 0.8
75 0.75
76 0.67
77 0.62
78 0.59
79 0.48
80 0.4
81 0.32
82 0.24
83 0.18
84 0.16
85 0.11
86 0.1
87 0.11
88 0.1
89 0.1
90 0.1
91 0.1
92 0.09
93 0.08
94 0.09
95 0.08
96 0.1
97 0.11
98 0.13
99 0.13
100 0.14
101 0.13
102 0.13
103 0.12
104 0.14
105 0.18
106 0.19
107 0.2
108 0.25
109 0.28
110 0.29
111 0.33
112 0.35
113 0.33
114 0.36
115 0.36
116 0.34
117 0.32
118 0.33
119 0.33
120 0.27
121 0.23
122 0.2
123 0.18
124 0.15
125 0.17
126 0.14
127 0.12
128 0.11
129 0.11
130 0.09
131 0.09
132 0.08
133 0.06
134 0.06
135 0.08
136 0.1
137 0.13
138 0.21
139 0.28
140 0.36
141 0.4
142 0.42
143 0.44
144 0.44
145 0.43
146 0.36
147 0.3
148 0.24
149 0.19
150 0.18
151 0.13
152 0.11
153 0.09
154 0.1
155 0.1
156 0.11
157 0.13
158 0.17
159 0.23
160 0.26
161 0.29
162 0.35
163 0.34
164 0.32
165 0.31
166 0.27
167 0.26
168 0.29
169 0.3
170 0.26
171 0.29
172 0.29
173 0.28
174 0.28
175 0.23
176 0.17
177 0.14
178 0.14
179 0.18
180 0.23
181 0.26
182 0.28
183 0.32
184 0.33
185 0.34
186 0.37
187 0.31
188 0.32
189 0.39
190 0.45
191 0.47
192 0.55
193 0.58
194 0.53
195 0.56
196 0.52
197 0.52
198 0.5
199 0.52
200 0.53
201 0.58
202 0.59
203 0.59
204 0.58
205 0.53
206 0.51
207 0.51