Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SD01

Protein Details
Accession A0A317SD01    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
127-152EDAHDMRKPMRRDKHQKSVRENGREVBasic
NLS Segment(s)
Subcellular Location(s) nucl 10.5, cyto_nucl 10, cyto 8.5, mito 4, cysk 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR016181  Acyl_CoA_acyltransferase  
IPR000182  GNAT_dom  
Gene Ontology GO:0016747  F:acyltransferase activity, transferring groups other than amino-acyl groups  
Pfam View protein in Pfam  
PF00583  Acetyltransf_1  
PROSITE View protein in PROSITE  
PS51186  GNAT  
CDD cd04301  NAT_SF  
Amino Acid Sequences MENYDISLYLRYLTKWRTLMSVTESSQGKIIGYIMGKAEGTAKDWHGHVTAVTAAPEYRRLGLAKTMMHELERVTTSMYHSNFVDLSVRVLNEITIGMYEGMGDLACPTVVEYYSASSGSGDGAGGEDAHDMRKPMRRDKHQKSVRENGREVRVLPQEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.29
3 0.3
4 0.31
5 0.31
6 0.33
7 0.33
8 0.36
9 0.3
10 0.33
11 0.33
12 0.3
13 0.3
14 0.27
15 0.2
16 0.15
17 0.14
18 0.11
19 0.11
20 0.11
21 0.1
22 0.11
23 0.11
24 0.1
25 0.13
26 0.1
27 0.13
28 0.14
29 0.14
30 0.15
31 0.16
32 0.17
33 0.15
34 0.15
35 0.12
36 0.11
37 0.11
38 0.09
39 0.09
40 0.08
41 0.08
42 0.08
43 0.11
44 0.1
45 0.1
46 0.11
47 0.11
48 0.12
49 0.14
50 0.17
51 0.15
52 0.16
53 0.17
54 0.16
55 0.15
56 0.15
57 0.12
58 0.11
59 0.11
60 0.09
61 0.08
62 0.08
63 0.1
64 0.14
65 0.15
66 0.14
67 0.13
68 0.14
69 0.13
70 0.13
71 0.13
72 0.08
73 0.09
74 0.08
75 0.08
76 0.08
77 0.08
78 0.07
79 0.06
80 0.06
81 0.04
82 0.04
83 0.04
84 0.04
85 0.04
86 0.04
87 0.03
88 0.03
89 0.03
90 0.03
91 0.03
92 0.03
93 0.03
94 0.03
95 0.03
96 0.04
97 0.04
98 0.06
99 0.06
100 0.07
101 0.08
102 0.09
103 0.08
104 0.08
105 0.08
106 0.07
107 0.07
108 0.05
109 0.04
110 0.05
111 0.05
112 0.05
113 0.05
114 0.05
115 0.06
116 0.07
117 0.08
118 0.09
119 0.12
120 0.2
121 0.25
122 0.35
123 0.45
124 0.55
125 0.65
126 0.74
127 0.81
128 0.82
129 0.86
130 0.85
131 0.86
132 0.84
133 0.82
134 0.78
135 0.74
136 0.73
137 0.66
138 0.58
139 0.55