Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317STD6

Protein Details
Accession A0A317STD6    Localization Confidence Medium Confidence Score 12.7
NoLS Segment(s)
PositionSequenceProtein Nature
49-75KGKIEECRERRKWKWKNKKWWNEEIEEBasic
NLS Segment(s)
PositionSequence
57-67ERRKWKWKNKK
Subcellular Location(s) nucl 17, cyto_nucl 13.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MEVRVCGWRVEKEEEKKGRVDWERGERVEKQRNREELEKLIEQVEGWIKGKIEECRERRKWKWKNKKWWNEEIEEEYRRGKERLKEEEIKTAKGDY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.59
2 0.58
3 0.56
4 0.53
5 0.54
6 0.51
7 0.49
8 0.46
9 0.49
10 0.52
11 0.52
12 0.54
13 0.51
14 0.54
15 0.59
16 0.55
17 0.53
18 0.55
19 0.59
20 0.6
21 0.58
22 0.52
23 0.47
24 0.47
25 0.41
26 0.33
27 0.29
28 0.23
29 0.19
30 0.17
31 0.14
32 0.1
33 0.1
34 0.1
35 0.09
36 0.11
37 0.14
38 0.15
39 0.2
40 0.28
41 0.32
42 0.41
43 0.49
44 0.56
45 0.61
46 0.69
47 0.73
48 0.76
49 0.82
50 0.83
51 0.87
52 0.9
53 0.93
54 0.9
55 0.9
56 0.84
57 0.76
58 0.71
59 0.66
60 0.61
61 0.53
62 0.46
63 0.39
64 0.36
65 0.35
66 0.32
67 0.31
68 0.33
69 0.39
70 0.47
71 0.53
72 0.59
73 0.59
74 0.68
75 0.65
76 0.6