Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SQ18

Protein Details
Accession A0A317SQ18    Localization Confidence Medium Confidence Score 10
NoLS Segment(s)
PositionSequenceProtein Nature
17-44NSHYPKKADERANPRKPRKQASKPSTPAHydrophilic
NLS Segment(s)
PositionSequence
23-49KADERANPRKPRKQASKPSTPAVAARN
88-92RRKWK
Subcellular Location(s) mito 26
Family & Domain DBs
Amino Acid Sequences MPTSRRVQVPLSFCSVNSHYPKKADERANPRKPRKQASKPSTPAVAARNPKGKEAVAVDLLVVGMNAYAAEKEASCQCTAQPGRAAIRRKWKP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.34
3 0.35
4 0.37
5 0.4
6 0.37
7 0.39
8 0.42
9 0.43
10 0.49
11 0.5
12 0.52
13 0.57
14 0.65
15 0.73
16 0.79
17 0.82
18 0.82
19 0.81
20 0.82
21 0.82
22 0.82
23 0.82
24 0.8
25 0.82
26 0.77
27 0.72
28 0.64
29 0.53
30 0.45
31 0.37
32 0.36
33 0.28
34 0.28
35 0.32
36 0.31
37 0.32
38 0.31
39 0.27
40 0.23
41 0.22
42 0.21
43 0.15
44 0.14
45 0.13
46 0.11
47 0.11
48 0.08
49 0.06
50 0.03
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.03
57 0.04
58 0.04
59 0.07
60 0.11
61 0.13
62 0.14
63 0.14
64 0.14
65 0.23
66 0.25
67 0.27
68 0.28
69 0.3
70 0.37
71 0.44
72 0.5
73 0.47