Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SUX8

Protein Details
Accession A0A317SUX8    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
8-37CPLPSRVPSRRERARPLRERKGRRWKGDAEBasic
NLS Segment(s)
PositionSequence
15-33PSRRERARPLRERKGRRWK
82-103RVEGKGRAKGKGEGERRASRKG
Subcellular Location(s) mito 17.5, cyto_mito 10.5, nucl 7
Family & Domain DBs
Amino Acid Sequences MSIELKFCPLPSRVPSRRERARPLRERKGRRWKGDAEELGVGERGEAMGGKCWRPIWEEGEEEDEVEEEGMEKEKLEKEMERVEGKGRAKGKGEGERRASRKGLMGGSGAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.56
3 0.62
4 0.7
5 0.72
6 0.77
7 0.77
8 0.81
9 0.84
10 0.86
11 0.87
12 0.87
13 0.88
14 0.89
15 0.89
16 0.88
17 0.85
18 0.81
19 0.77
20 0.73
21 0.73
22 0.64
23 0.55
24 0.47
25 0.39
26 0.33
27 0.27
28 0.19
29 0.1
30 0.08
31 0.05
32 0.04
33 0.04
34 0.04
35 0.09
36 0.1
37 0.11
38 0.12
39 0.12
40 0.13
41 0.15
42 0.17
43 0.16
44 0.17
45 0.18
46 0.18
47 0.21
48 0.2
49 0.17
50 0.15
51 0.12
52 0.09
53 0.07
54 0.06
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.08
61 0.1
62 0.12
63 0.13
64 0.14
65 0.17
66 0.22
67 0.26
68 0.26
69 0.25
70 0.26
71 0.31
72 0.31
73 0.33
74 0.31
75 0.31
76 0.33
77 0.37
78 0.42
79 0.45
80 0.5
81 0.52
82 0.57
83 0.63
84 0.63
85 0.63
86 0.58
87 0.5
88 0.49
89 0.46
90 0.4
91 0.33