Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SPG3

Protein Details
Accession A0A317SPG3    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-39AKAARIKKPTKKGSNTVKFKHydrophilic
NLS Segment(s)
PositionSequence
23-31ARIKKPTKK
Subcellular Location(s) nucl 20, cyto_nucl 14.5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002675  Ribosomal_L38e  
IPR038464  Ribosomal_L38e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01781  Ribosomal_L38e  
Amino Acid Sequences MPKQVHDIKQFLELCNRADAKAARIKKPTKKGSNTVKFKVRCHRHLYTLVLHDSEKADKLKQSLPPALSTTDVPATSKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.37
3 0.36
4 0.27
5 0.3
6 0.29
7 0.27
8 0.33
9 0.37
10 0.36
11 0.43
12 0.51
13 0.55
14 0.64
15 0.69
16 0.7
17 0.71
18 0.75
19 0.78
20 0.8
21 0.78
22 0.74
23 0.72
24 0.66
25 0.64
26 0.65
27 0.61
28 0.57
29 0.57
30 0.55
31 0.51
32 0.52
33 0.51
34 0.45
35 0.42
36 0.37
37 0.3
38 0.27
39 0.23
40 0.21
41 0.19
42 0.18
43 0.16
44 0.16
45 0.17
46 0.21
47 0.25
48 0.29
49 0.34
50 0.37
51 0.37
52 0.38
53 0.38
54 0.36
55 0.33
56 0.28
57 0.25
58 0.23
59 0.21