Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1C579

Protein Details
Accession A1C579   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
242-268TPPAPSFARVKKPKKPLVNGLGIKKKPHydrophilic
NLS Segment(s)
PositionSequence
250-270RVKKPKKPLVNGLGIKKKPKP
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007590  Saf4/Yju2  
IPR043701  Yju2  
Gene Ontology GO:0071006  C:U2-type catalytic step 1 spliceosome  
GO:0071007  C:U2-type catalytic step 2 spliceosome  
GO:0000384  F:first spliceosomal transesterification activity  
GO:0046872  F:metal ion binding  
GO:0030620  F:U2 snRNA binding  
GO:0000349  P:generation of catalytic spliceosome for first transesterification step  
GO:0000350  P:generation of catalytic spliceosome for second transesterification step  
KEGG act:ACLA_002580  -  
Pfam View protein in Pfam  
PF04502  Saf4_Yju2  
Amino Acid Sequences MSERKVLSKYYPPDFDPSSIGRTPKHLPSTGPKVITVRLMAPFSMKCTHCGEYIYKGRKFNARKETTDQKYLNIPIYRFYIRCTRCSGEITFLTDPKAMDYKAEKGAKRNFEPWRDAKADIEETEQETLDRLEREENEEQERLERDKMAELEEKMLDSKREMAIADALDEIRTRNARIERNEALGDEAALAHVRDEVDEERLRIEKEIEEAARRAFTTETGEKVKRLVDEEALGGAPLETETPPAPSFARVKKPKKPLVNGLGIKKKPKPSLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.47
3 0.42
4 0.38
5 0.37
6 0.36
7 0.36
8 0.31
9 0.33
10 0.37
11 0.4
12 0.44
13 0.4
14 0.41
15 0.47
16 0.55
17 0.56
18 0.52
19 0.46
20 0.42
21 0.42
22 0.4
23 0.33
24 0.27
25 0.24
26 0.23
27 0.21
28 0.22
29 0.21
30 0.22
31 0.27
32 0.25
33 0.24
34 0.28
35 0.3
36 0.28
37 0.31
38 0.29
39 0.31
40 0.4
41 0.45
42 0.45
43 0.46
44 0.48
45 0.54
46 0.57
47 0.58
48 0.59
49 0.57
50 0.58
51 0.62
52 0.69
53 0.66
54 0.69
55 0.6
56 0.51
57 0.5
58 0.48
59 0.47
60 0.4
61 0.35
62 0.28
63 0.32
64 0.33
65 0.27
66 0.28
67 0.31
68 0.29
69 0.32
70 0.35
71 0.33
72 0.33
73 0.36
74 0.35
75 0.3
76 0.29
77 0.32
78 0.27
79 0.25
80 0.24
81 0.22
82 0.21
83 0.17
84 0.18
85 0.13
86 0.14
87 0.16
88 0.18
89 0.25
90 0.3
91 0.29
92 0.34
93 0.41
94 0.45
95 0.46
96 0.5
97 0.48
98 0.47
99 0.53
100 0.49
101 0.48
102 0.44
103 0.42
104 0.35
105 0.32
106 0.29
107 0.23
108 0.22
109 0.16
110 0.15
111 0.15
112 0.13
113 0.1
114 0.09
115 0.08
116 0.08
117 0.08
118 0.07
119 0.09
120 0.09
121 0.15
122 0.16
123 0.18
124 0.19
125 0.19
126 0.19
127 0.19
128 0.2
129 0.17
130 0.15
131 0.14
132 0.12
133 0.14
134 0.14
135 0.15
136 0.16
137 0.15
138 0.16
139 0.16
140 0.15
141 0.14
142 0.14
143 0.12
144 0.1
145 0.12
146 0.1
147 0.11
148 0.11
149 0.1
150 0.11
151 0.11
152 0.11
153 0.08
154 0.08
155 0.07
156 0.08
157 0.07
158 0.08
159 0.09
160 0.09
161 0.14
162 0.2
163 0.26
164 0.29
165 0.36
166 0.35
167 0.37
168 0.37
169 0.32
170 0.28
171 0.22
172 0.18
173 0.11
174 0.09
175 0.06
176 0.06
177 0.06
178 0.04
179 0.05
180 0.05
181 0.05
182 0.08
183 0.08
184 0.13
185 0.14
186 0.14
187 0.15
188 0.17
189 0.18
190 0.16
191 0.17
192 0.13
193 0.14
194 0.18
195 0.18
196 0.19
197 0.2
198 0.2
199 0.2
200 0.19
201 0.18
202 0.14
203 0.14
204 0.18
205 0.2
206 0.23
207 0.28
208 0.29
209 0.29
210 0.3
211 0.31
212 0.26
213 0.27
214 0.25
215 0.21
216 0.21
217 0.21
218 0.2
219 0.18
220 0.15
221 0.12
222 0.09
223 0.07
224 0.06
225 0.06
226 0.05
227 0.07
228 0.08
229 0.11
230 0.12
231 0.14
232 0.14
233 0.18
234 0.25
235 0.31
236 0.41
237 0.49
238 0.57
239 0.65
240 0.75
241 0.8
242 0.83
243 0.84
244 0.83
245 0.82
246 0.84
247 0.81
248 0.8
249 0.81
250 0.75
251 0.74
252 0.71
253 0.71