Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SS77

Protein Details
Accession A0A317SS77    Localization Confidence High Confidence Score 16
NoLS Segment(s)
PositionSequenceProtein Nature
46-71MGEKGRGILRNRRKRRKRILGEEMGEBasic
NLS Segment(s)
PositionSequence
49-63KGRGILRNRRKRRKR
Subcellular Location(s) nucl 20, cyto 5
Family & Domain DBs
Amino Acid Sequences IPGHVGLEENEEADEWAQEGCFEEEEEERGNEKGKREEDVEGILGMGEKGRGILRNRRKRRKRILGEEMGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.06
3 0.06
4 0.05
5 0.05
6 0.07
7 0.07
8 0.07
9 0.07
10 0.08
11 0.09
12 0.11
13 0.12
14 0.1
15 0.11
16 0.11
17 0.14
18 0.15
19 0.17
20 0.21
21 0.2
22 0.22
23 0.22
24 0.24
25 0.21
26 0.2
27 0.18
28 0.13
29 0.12
30 0.09
31 0.08
32 0.06
33 0.05
34 0.04
35 0.03
36 0.04
37 0.05
38 0.11
39 0.15
40 0.26
41 0.37
42 0.48
43 0.6
44 0.7
45 0.8
46 0.86
47 0.93
48 0.94
49 0.94
50 0.93
51 0.93