Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SZ22

Protein Details
Accession A0A317SZ22   
Localization Confidence Medium
Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
157-187RIPLRYQDKYPSVRRRRHRCPNRGGAPNGVRHydrophilic
NLS Segment(s)
PositionSequence
171-175RRRHR
Subcellular Location(s) nucl 11, cyto_nucl 9.5, mito 9, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR043358  GNL1-like  
IPR006073  GTP-bd  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005525  F:GTP binding  
GO:0003924  F:GTPase activity  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
Amino Acid Sequences MRGFGERSAWADYFEKERISYRFFSAALAKQINEEYYSVDEEGEPVEEEKEELRIRILTVDELEEDEDLESPRKTQIGLVGYPNVGKSSTINASIGAKKVSVSSTLGKTGHLQTLHLGEKIAFCDCPSLGFPNFATTKAELRPNNTRSATDPPASSRIPLRYQDKYPSVRRRRHRCPNRGGAPNGVRRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.25
3 0.22
4 0.27
5 0.28
6 0.3
7 0.31
8 0.3
9 0.31
10 0.29
11 0.3
12 0.31
13 0.31
14 0.32
15 0.31
16 0.28
17 0.26
18 0.27
19 0.26
20 0.22
21 0.18
22 0.14
23 0.14
24 0.16
25 0.14
26 0.13
27 0.12
28 0.11
29 0.11
30 0.1
31 0.08
32 0.07
33 0.07
34 0.07
35 0.08
36 0.08
37 0.12
38 0.11
39 0.11
40 0.12
41 0.12
42 0.12
43 0.13
44 0.14
45 0.1
46 0.1
47 0.1
48 0.09
49 0.09
50 0.09
51 0.08
52 0.07
53 0.06
54 0.06
55 0.07
56 0.08
57 0.07
58 0.08
59 0.09
60 0.09
61 0.09
62 0.09
63 0.13
64 0.14
65 0.16
66 0.17
67 0.17
68 0.17
69 0.17
70 0.16
71 0.12
72 0.09
73 0.08
74 0.07
75 0.09
76 0.1
77 0.11
78 0.11
79 0.11
80 0.13
81 0.14
82 0.14
83 0.11
84 0.1
85 0.09
86 0.1
87 0.1
88 0.09
89 0.1
90 0.12
91 0.13
92 0.16
93 0.16
94 0.16
95 0.18
96 0.18
97 0.19
98 0.16
99 0.15
100 0.13
101 0.18
102 0.18
103 0.16
104 0.15
105 0.12
106 0.12
107 0.13
108 0.13
109 0.09
110 0.07
111 0.09
112 0.09
113 0.1
114 0.11
115 0.13
116 0.13
117 0.15
118 0.15
119 0.18
120 0.19
121 0.18
122 0.2
123 0.17
124 0.2
125 0.22
126 0.29
127 0.26
128 0.31
129 0.4
130 0.4
131 0.46
132 0.44
133 0.42
134 0.38
135 0.44
136 0.43
137 0.36
138 0.35
139 0.31
140 0.35
141 0.34
142 0.32
143 0.29
144 0.3
145 0.33
146 0.38
147 0.41
148 0.42
149 0.46
150 0.53
151 0.55
152 0.58
153 0.63
154 0.67
155 0.71
156 0.74
157 0.81
158 0.83
159 0.86
160 0.9
161 0.91
162 0.9
163 0.91
164 0.92
165 0.91
166 0.9
167 0.82
168 0.81
169 0.78