Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SPC1

Protein Details
Accession A0A317SPC1   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
96-126GEATKIEKASRQQRKQRKNRAKESRGTAKAKHydrophilic
NLS Segment(s)
PositionSequence
102-133EKASRQQRKQRKNRAKESRGTAKAKAGKDKKK
Subcellular Location(s) mito 17, nucl 5, cyto 5, cyto_nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012678  Ribosomal_L23/L15e_core_dom_sf  
IPR001976  Ribosomal_S24e  
IPR018098  Ribosomal_S24e_CS  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01282  Ribosomal_S24e  
PROSITE View protein in PROSITE  
PS00529  RIBOSOMAL_S24E  
Amino Acid Sequences MSESQVTLRTRKFIRNALLGRKQMVVDVLHPNRPNVSKDDLRTKLAELYSANKNQVSVFGFRTQYGGGKSTGFALIYDSYETLKKFEPHYRLVRFGEATKIEKASRQQRKQRKNRAKESRGTAKAKAGKDKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.55
3 0.6
4 0.63
5 0.67
6 0.62
7 0.57
8 0.52
9 0.45
10 0.36
11 0.32
12 0.24
13 0.19
14 0.26
15 0.27
16 0.31
17 0.32
18 0.32
19 0.33
20 0.34
21 0.33
22 0.28
23 0.32
24 0.31
25 0.34
26 0.43
27 0.42
28 0.42
29 0.41
30 0.38
31 0.35
32 0.3
33 0.27
34 0.19
35 0.2
36 0.23
37 0.24
38 0.24
39 0.2
40 0.21
41 0.18
42 0.2
43 0.18
44 0.14
45 0.15
46 0.17
47 0.18
48 0.17
49 0.18
50 0.16
51 0.15
52 0.14
53 0.14
54 0.11
55 0.1
56 0.1
57 0.1
58 0.1
59 0.09
60 0.07
61 0.08
62 0.08
63 0.08
64 0.08
65 0.07
66 0.08
67 0.1
68 0.1
69 0.1
70 0.12
71 0.14
72 0.18
73 0.24
74 0.28
75 0.34
76 0.42
77 0.44
78 0.46
79 0.46
80 0.45
81 0.4
82 0.36
83 0.35
84 0.3
85 0.29
86 0.26
87 0.27
88 0.24
89 0.26
90 0.33
91 0.38
92 0.46
93 0.53
94 0.61
95 0.69
96 0.8
97 0.87
98 0.91
99 0.92
100 0.92
101 0.93
102 0.94
103 0.92
104 0.89
105 0.88
106 0.87
107 0.85
108 0.79
109 0.71
110 0.69
111 0.68
112 0.65
113 0.66