Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SZ67

Protein Details
Accession A0A317SZ67    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
44-83DDIAWKRKEKKRMERGESRKVEERKRTRKMETQKSPPPVFBasic
NLS Segment(s)
PositionSequence
49-73KRKEKKRMERGESRKVEERKRTRKM
Subcellular Location(s) mito 11, E.R. 5, plas 4, golg 4, nucl 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPTLRVPPISFSLTRPQNTYPYLFVALLPVLIHNGVTLFLPALDDIAWKRKEKKRMERGESRKVEERKRTRKMETQKSPPPVF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.38
4 0.39
5 0.41
6 0.4
7 0.32
8 0.28
9 0.28
10 0.24
11 0.21
12 0.17
13 0.15
14 0.12
15 0.1
16 0.07
17 0.06
18 0.05
19 0.05
20 0.04
21 0.04
22 0.04
23 0.04
24 0.04
25 0.03
26 0.03
27 0.04
28 0.03
29 0.04
30 0.03
31 0.04
32 0.05
33 0.12
34 0.14
35 0.16
36 0.25
37 0.31
38 0.41
39 0.5
40 0.61
41 0.64
42 0.73
43 0.79
44 0.82
45 0.84
46 0.86
47 0.81
48 0.75
49 0.74
50 0.7
51 0.71
52 0.71
53 0.73
54 0.73
55 0.77
56 0.79
57 0.77
58 0.8
59 0.82
60 0.83
61 0.82
62 0.82
63 0.81