Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SY64

Protein Details
Accession A0A317SY64    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
93-121FNDVSKYSAKYKRQKRRVPKLDSRPYVKEHydrophilic
NLS Segment(s)
PositionSequence
104-109KRQKRR
Subcellular Location(s) mito 12, cyto 10, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR024661  RNA_pol_III_Rpc31  
Gene Ontology GO:0005634  C:nucleus  
GO:0006383  P:transcription by RNA polymerase III  
Pfam View protein in Pfam  
PF11705  RNA_pol_3_Rpc31  
Amino Acid Sequences MSRGGRGGFRGGGNFGGGGGGGGGMGGPFGHDPDNPPDYSTTELFPPQPPPVPNPLSKNERHIVARYRLYREKIHNGPLYTVMGKKRGMEDPFNDVSKYSAKYKRQKRRVPKLDSRPYVKEFFPEELWDTLGIDGD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.13
3 0.1
4 0.08
5 0.06
6 0.04
7 0.03
8 0.03
9 0.02
10 0.02
11 0.02
12 0.02
13 0.02
14 0.03
15 0.03
16 0.04
17 0.06
18 0.06
19 0.1
20 0.16
21 0.19
22 0.19
23 0.19
24 0.2
25 0.2
26 0.23
27 0.21
28 0.17
29 0.15
30 0.16
31 0.17
32 0.18
33 0.19
34 0.18
35 0.22
36 0.22
37 0.23
38 0.29
39 0.3
40 0.33
41 0.34
42 0.38
43 0.39
44 0.39
45 0.42
46 0.36
47 0.36
48 0.34
49 0.33
50 0.32
51 0.32
52 0.37
53 0.34
54 0.38
55 0.39
56 0.41
57 0.42
58 0.42
59 0.44
60 0.41
61 0.45
62 0.43
63 0.4
64 0.37
65 0.34
66 0.31
67 0.24
68 0.23
69 0.18
70 0.18
71 0.18
72 0.18
73 0.2
74 0.24
75 0.26
76 0.27
77 0.28
78 0.31
79 0.34
80 0.34
81 0.31
82 0.25
83 0.24
84 0.23
85 0.23
86 0.24
87 0.29
88 0.38
89 0.48
90 0.58
91 0.68
92 0.75
93 0.83
94 0.86
95 0.9
96 0.91
97 0.91
98 0.91
99 0.91
100 0.91
101 0.89
102 0.85
103 0.8
104 0.74
105 0.68
106 0.58
107 0.52
108 0.45
109 0.41
110 0.36
111 0.33
112 0.31
113 0.28
114 0.29
115 0.24
116 0.21