Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SRP7

Protein Details
Accession A0A317SRP7   
Localization Confidence Medium
Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
49-87KKKAATHTKKANQGKRREKRAERKGKEKKCRKKERKKRKBasic
NLS Segment(s)
PositionSequence
49-87KKKAATHTKKANQGKRREKRAERKGKEKKCRKKERKKRK
Subcellular Location(s) nucl 21.5, cyto_nucl 13, mito 4
Family & Domain DBs
Amino Acid Sequences MHISQKDSHFLYTDFHPHLLHTRYSTQSPVDYHTANNINEGSSPIGVEKKKAATHTKKANQGKRREKRAERKGKEKKCRKKERKKRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.24
4 0.23
5 0.29
6 0.29
7 0.27
8 0.24
9 0.27
10 0.28
11 0.3
12 0.31
13 0.26
14 0.25
15 0.24
16 0.25
17 0.23
18 0.21
19 0.19
20 0.22
21 0.26
22 0.23
23 0.23
24 0.19
25 0.16
26 0.16
27 0.17
28 0.12
29 0.07
30 0.07
31 0.07
32 0.1
33 0.1
34 0.11
35 0.12
36 0.15
37 0.17
38 0.21
39 0.3
40 0.34
41 0.43
42 0.52
43 0.57
44 0.64
45 0.71
46 0.76
47 0.75
48 0.78
49 0.81
50 0.8
51 0.84
52 0.84
53 0.86
54 0.88
55 0.9
56 0.91
57 0.88
58 0.89
59 0.9
60 0.91
61 0.91
62 0.91
63 0.91
64 0.91
65 0.95
66 0.95
67 0.96