Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SQ45

Protein Details
Accession A0A317SQ45    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
37-57GVYKNKPTKYRQYMNRPGGFNHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 13, cyto 12, nucl 10, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR013957  SNRNP27  
Gene Ontology GO:0005634  C:nucleus  
GO:0006397  P:mRNA processing  
GO:0008380  P:RNA splicing  
Pfam View protein in Pfam  
PF08648  SNRNP27  
Amino Acid Sequences EMEGVVDDEEAQMQALMGFGGFGTTKQKKVRGNDVGGVYKNKPTKYRQYMNRPGGFNRALSPS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.04
2 0.04
3 0.04
4 0.03
5 0.03
6 0.03
7 0.03
8 0.03
9 0.04
10 0.11
11 0.13
12 0.18
13 0.22
14 0.28
15 0.33
16 0.37
17 0.46
18 0.45
19 0.46
20 0.45
21 0.45
22 0.43
23 0.39
24 0.38
25 0.29
26 0.29
27 0.3
28 0.29
29 0.3
30 0.33
31 0.43
32 0.49
33 0.58
34 0.62
35 0.69
36 0.77
37 0.82
38 0.83
39 0.75
40 0.68
41 0.66
42 0.58
43 0.48