Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317T2Q5

Protein Details
Accession A0A317T2Q5    Localization Confidence Low Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
121-140GDPGRLQKWHHGRRLRQHMVBasic
NLS Segment(s)
Subcellular Location(s) cysk 15, mito 7, nucl 3
Family & Domain DBs
Amino Acid Sequences MSHWFSEIERIMTDGIVFRHLIGATQYNDSHLGELLHPHLVGVESTQRTNGPVVPIPSRGDDEPGTPPPHGQLDRVQNNQKEEEEKVVEQEETEKDKEEEEXFLGVAGMRIKMTMMRSSGPGDPGRLQKWHHGRRLRQHMVPAHHTEEDHLPEWLSTLPGSAIWL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.12
3 0.12
4 0.12
5 0.11
6 0.13
7 0.13
8 0.13
9 0.13
10 0.17
11 0.17
12 0.2
13 0.2
14 0.19
15 0.21
16 0.2
17 0.18
18 0.14
19 0.14
20 0.11
21 0.13
22 0.12
23 0.12
24 0.11
25 0.1
26 0.1
27 0.09
28 0.09
29 0.08
30 0.13
31 0.13
32 0.14
33 0.15
34 0.15
35 0.15
36 0.16
37 0.17
38 0.14
39 0.15
40 0.18
41 0.19
42 0.21
43 0.21
44 0.21
45 0.22
46 0.19
47 0.19
48 0.17
49 0.17
50 0.19
51 0.21
52 0.22
53 0.19
54 0.19
55 0.18
56 0.22
57 0.2
58 0.18
59 0.2
60 0.27
61 0.33
62 0.38
63 0.42
64 0.39
65 0.41
66 0.41
67 0.36
68 0.29
69 0.24
70 0.22
71 0.19
72 0.16
73 0.15
74 0.14
75 0.13
76 0.11
77 0.13
78 0.12
79 0.14
80 0.14
81 0.15
82 0.14
83 0.15
84 0.15
85 0.14
86 0.12
87 0.09
88 0.09
89 0.07
90 0.08
91 0.07
92 0.07
93 0.07
94 0.07
95 0.06
96 0.05
97 0.06
98 0.07
99 0.09
100 0.12
101 0.12
102 0.13
103 0.15
104 0.18
105 0.19
106 0.21
107 0.2
108 0.2
109 0.23
110 0.27
111 0.28
112 0.29
113 0.29
114 0.35
115 0.45
116 0.51
117 0.56
118 0.6
119 0.65
120 0.73
121 0.82
122 0.79
123 0.72
124 0.72
125 0.7
126 0.68
127 0.66
128 0.61
129 0.54
130 0.48
131 0.45
132 0.4
133 0.37
134 0.35
135 0.3
136 0.25
137 0.21
138 0.19
139 0.21
140 0.18
141 0.14
142 0.09
143 0.09
144 0.09