Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SI13

Protein Details
Accession A0A317SI13    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-49AAARKHIPIVKKRTKRFNRHQSDRYKTVKAAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
5-48RKHIPIVKKRTKRFNRHQSDRYKTVKAAWRKPKGIDNRVRRRFK
Subcellular Location(s) mito 18, cyto 5, nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAAARKHIPIVKKRTKRFNRHQSDRYKTVKAAWRKPKGIDNRVRRRFKGQAVMPSIGFGSNRKTRHMMPSGHKAFLVQNTSDLDLLLMHNKTYAAEIGHAVSSRKRIEIIAKAKTLGVKVTNPKGRITTDA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.85
3 0.88
4 0.9
5 0.9
6 0.9
7 0.91
8 0.91
9 0.9
10 0.88
11 0.85
12 0.8
13 0.73
14 0.63
15 0.6
16 0.6
17 0.59
18 0.61
19 0.63
20 0.65
21 0.65
22 0.67
23 0.68
24 0.69
25 0.7
26 0.7
27 0.7
28 0.72
29 0.79
30 0.82
31 0.75
32 0.73
33 0.69
34 0.65
35 0.63
36 0.56
37 0.54
38 0.53
39 0.52
40 0.44
41 0.38
42 0.32
43 0.23
44 0.19
45 0.12
46 0.13
47 0.17
48 0.18
49 0.2
50 0.23
51 0.24
52 0.31
53 0.36
54 0.36
55 0.35
56 0.44
57 0.45
58 0.42
59 0.41
60 0.35
61 0.3
62 0.29
63 0.26
64 0.16
65 0.15
66 0.16
67 0.17
68 0.16
69 0.14
70 0.1
71 0.08
72 0.08
73 0.1
74 0.09
75 0.08
76 0.08
77 0.09
78 0.09
79 0.09
80 0.1
81 0.07
82 0.08
83 0.09
84 0.09
85 0.1
86 0.11
87 0.11
88 0.12
89 0.17
90 0.17
91 0.18
92 0.18
93 0.19
94 0.24
95 0.33
96 0.38
97 0.4
98 0.4
99 0.4
100 0.4
101 0.4
102 0.35
103 0.29
104 0.26
105 0.26
106 0.33
107 0.42
108 0.48
109 0.47
110 0.49
111 0.49