Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A1C848

Protein Details
Accession A1C848    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
168-189KNGDPSPTKKMEKKTKPGKQVKBasic
NLS Segment(s)
PositionSequence
155-189KEKEKEKEKPKALKNGDPSPTKKMEKKTKPGKQVK
Subcellular Location(s) nucl 14, cyto_nucl 11.333, mito_nucl 10.499, mito 5.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038212  TF_EnY2_sf  
KEGG act:ACLA_076090  -  
Amino Acid Sequences MPSTKTTPSSPQLLSPDSLETDLLTHLAQTTALEDLHTTLLSSLQRLGWTEKIRKLSLELLRAGRCERFDDVVEAVVASAAGMHPFAPSADDGSDDEDLNVDVRIPKAVVEQGVRALKEVLRDVIVLDDDPDLTALQQSERAEKTGSSLEGEAEKEKEKEKEKPKALKNGDPSPTKKMEKKTKPGKQVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.33
3 0.3
4 0.26
5 0.25
6 0.19
7 0.15
8 0.13
9 0.12
10 0.11
11 0.09
12 0.07
13 0.07
14 0.07
15 0.07
16 0.06
17 0.07
18 0.07
19 0.07
20 0.07
21 0.07
22 0.08
23 0.09
24 0.09
25 0.08
26 0.07
27 0.1
28 0.1
29 0.11
30 0.11
31 0.11
32 0.12
33 0.13
34 0.17
35 0.2
36 0.26
37 0.31
38 0.35
39 0.39
40 0.39
41 0.38
42 0.37
43 0.39
44 0.37
45 0.35
46 0.34
47 0.33
48 0.33
49 0.34
50 0.32
51 0.26
52 0.22
53 0.21
54 0.2
55 0.18
56 0.17
57 0.18
58 0.17
59 0.16
60 0.14
61 0.12
62 0.09
63 0.07
64 0.06
65 0.03
66 0.03
67 0.02
68 0.02
69 0.03
70 0.03
71 0.03
72 0.03
73 0.03
74 0.04
75 0.04
76 0.05
77 0.05
78 0.06
79 0.06
80 0.08
81 0.09
82 0.08
83 0.08
84 0.07
85 0.07
86 0.06
87 0.06
88 0.04
89 0.04
90 0.05
91 0.05
92 0.05
93 0.05
94 0.06
95 0.07
96 0.09
97 0.09
98 0.09
99 0.14
100 0.16
101 0.15
102 0.15
103 0.15
104 0.14
105 0.15
106 0.15
107 0.12
108 0.1
109 0.1
110 0.1
111 0.1
112 0.09
113 0.07
114 0.07
115 0.06
116 0.06
117 0.06
118 0.06
119 0.05
120 0.05
121 0.06
122 0.06
123 0.06
124 0.1
125 0.1
126 0.15
127 0.16
128 0.17
129 0.17
130 0.16
131 0.19
132 0.19
133 0.19
134 0.16
135 0.16
136 0.15
137 0.16
138 0.18
139 0.17
140 0.15
141 0.17
142 0.17
143 0.21
144 0.27
145 0.3
146 0.39
147 0.47
148 0.55
149 0.62
150 0.7
151 0.74
152 0.79
153 0.8
154 0.79
155 0.77
156 0.76
157 0.73
158 0.71
159 0.67
160 0.64
161 0.65
162 0.64
163 0.63
164 0.64
165 0.68
166 0.71
167 0.78
168 0.82
169 0.83