Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SPD3

Protein Details
Accession A0A317SPD3   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
75-116IPPPKKVRGTGRVKRKKKLPATPTPLPTPHERKKARLKRWNKBasic
NLS Segment(s)
PositionSequence
77-116PPKKVRGTGRVKRKKKLPATPTPLPTPHERKKARLKRWNK
Subcellular Location(s) plas 9, mito 8, cyto 5, extr 2, pero 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MPLAGGALRLPGFGHCTGGITFARGVENLIITITITIIITIIIVWPSPPYGTGIILLLGYREVAPACLIWLTIHIPPPKKVRGTGRVKRKKKLPATPTPLPTPHERKKARLKRWNK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.13
3 0.15
4 0.15
5 0.17
6 0.16
7 0.14
8 0.14
9 0.13
10 0.14
11 0.11
12 0.12
13 0.1
14 0.1
15 0.08
16 0.08
17 0.07
18 0.06
19 0.06
20 0.05
21 0.04
22 0.04
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.03
30 0.03
31 0.03
32 0.04
33 0.04
34 0.04
35 0.05
36 0.06
37 0.07
38 0.07
39 0.07
40 0.07
41 0.07
42 0.07
43 0.06
44 0.05
45 0.04
46 0.04
47 0.03
48 0.04
49 0.03
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.05
58 0.07
59 0.08
60 0.14
61 0.17
62 0.2
63 0.24
64 0.3
65 0.34
66 0.34
67 0.38
68 0.41
69 0.48
70 0.56
71 0.61
72 0.67
73 0.73
74 0.78
75 0.8
76 0.8
77 0.8
78 0.8
79 0.82
80 0.8
81 0.8
82 0.81
83 0.81
84 0.78
85 0.74
86 0.67
87 0.6
88 0.59
89 0.58
90 0.59
91 0.61
92 0.61
93 0.64
94 0.72
95 0.79
96 0.81