Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SD35

Protein Details
Accession A0A317SD35    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
51-72LRAVPKKKQSHSRKRMRQLAGKBasic
NLS Segment(s)
PositionSequence
55-66PKKKQSHSRKRM
Subcellular Location(s) mito 19, cyto_mito 13.5, cyto 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR002677  Ribosomal_L32p  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0015934  C:large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01783  Ribosomal_L32p  
Amino Acid Sequences MATPLLSVTRLCLLHPTRSLLPILRLPTLAIPAAIHLNIPNLLPGIWESILRAVPKKKQSHSRKRMRQLAGKALLDITALVKCPACGKIKRSNMLCEPCVNDIKSMWKEEAVEEAATKEGRPTTSP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.33
3 0.36
4 0.33
5 0.35
6 0.37
7 0.3
8 0.31
9 0.29
10 0.29
11 0.25
12 0.23
13 0.22
14 0.21
15 0.21
16 0.17
17 0.12
18 0.09
19 0.09
20 0.1
21 0.1
22 0.09
23 0.07
24 0.08
25 0.08
26 0.08
27 0.08
28 0.07
29 0.06
30 0.06
31 0.07
32 0.08
33 0.07
34 0.07
35 0.07
36 0.09
37 0.11
38 0.11
39 0.15
40 0.16
41 0.22
42 0.3
43 0.36
44 0.39
45 0.48
46 0.59
47 0.67
48 0.74
49 0.79
50 0.8
51 0.83
52 0.87
53 0.82
54 0.78
55 0.72
56 0.7
57 0.64
58 0.55
59 0.46
60 0.36
61 0.31
62 0.23
63 0.18
64 0.1
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.08
71 0.12
72 0.17
73 0.21
74 0.26
75 0.36
76 0.43
77 0.5
78 0.52
79 0.54
80 0.57
81 0.59
82 0.55
83 0.48
84 0.44
85 0.41
86 0.42
87 0.36
88 0.29
89 0.24
90 0.31
91 0.31
92 0.31
93 0.27
94 0.25
95 0.25
96 0.24
97 0.28
98 0.22
99 0.19
100 0.17
101 0.17
102 0.18
103 0.17
104 0.16
105 0.15
106 0.15