Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SXM5

Protein Details
Accession A0A317SXM5    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
90-112LLTSTPHPTKKRKRNDPGVFSTTHydrophilic
NLS Segment(s)
PositionSequence
149-168KARRVLREEKRKELEKGRVR
Subcellular Location(s) nucl 18.5, cyto_nucl 11.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012459  Rrp15  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF07890  Rrp15p  
Amino Acid Sequences MPSHVTKKRRTSATADAKNKTIPAEGINKPASPSASSSSDSESSTGADTVDLNRASEGSDSEANKYPLSSSPGATDSEDDSNSDDNLSDLLTSTPHPTKKRKRNDPGVFSTTMSKILSSHLTTTARRDPVLVRAKHSAVGVDESKIETKARRVLREEKRKELEKGRVREVVPKDDDEAARKALELEKRLRKTAQRGVIKLFNAVRAAQIKGEEGSRAVKREGVVGLAKREEKVTEMSKQGFLSLIQSGGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.73
3 0.68
4 0.64
5 0.61
6 0.54
7 0.45
8 0.36
9 0.27
10 0.24
11 0.29
12 0.29
13 0.34
14 0.35
15 0.34
16 0.33
17 0.33
18 0.3
19 0.24
20 0.24
21 0.22
22 0.23
23 0.24
24 0.25
25 0.27
26 0.27
27 0.26
28 0.23
29 0.19
30 0.16
31 0.15
32 0.14
33 0.1
34 0.09
35 0.09
36 0.1
37 0.15
38 0.14
39 0.13
40 0.13
41 0.13
42 0.13
43 0.13
44 0.12
45 0.1
46 0.15
47 0.15
48 0.19
49 0.24
50 0.24
51 0.24
52 0.23
53 0.21
54 0.19
55 0.24
56 0.22
57 0.18
58 0.19
59 0.2
60 0.22
61 0.2
62 0.19
63 0.15
64 0.16
65 0.16
66 0.14
67 0.14
68 0.13
69 0.13
70 0.12
71 0.09
72 0.07
73 0.07
74 0.06
75 0.05
76 0.04
77 0.05
78 0.05
79 0.06
80 0.1
81 0.14
82 0.19
83 0.25
84 0.35
85 0.45
86 0.55
87 0.65
88 0.72
89 0.78
90 0.84
91 0.87
92 0.85
93 0.82
94 0.76
95 0.66
96 0.56
97 0.49
98 0.38
99 0.3
100 0.22
101 0.15
102 0.11
103 0.11
104 0.13
105 0.11
106 0.11
107 0.13
108 0.16
109 0.16
110 0.2
111 0.23
112 0.22
113 0.21
114 0.21
115 0.19
116 0.26
117 0.34
118 0.31
119 0.29
120 0.31
121 0.31
122 0.32
123 0.31
124 0.22
125 0.14
126 0.16
127 0.14
128 0.11
129 0.11
130 0.11
131 0.11
132 0.11
133 0.12
134 0.1
135 0.13
136 0.2
137 0.24
138 0.27
139 0.32
140 0.41
141 0.51
142 0.61
143 0.63
144 0.65
145 0.66
146 0.67
147 0.67
148 0.64
149 0.64
150 0.61
151 0.61
152 0.57
153 0.56
154 0.52
155 0.55
156 0.52
157 0.49
158 0.43
159 0.39
160 0.36
161 0.34
162 0.34
163 0.3
164 0.28
165 0.22
166 0.19
167 0.18
168 0.17
169 0.18
170 0.22
171 0.23
172 0.3
173 0.38
174 0.42
175 0.45
176 0.48
177 0.5
178 0.54
179 0.58
180 0.59
181 0.57
182 0.56
183 0.59
184 0.6
185 0.54
186 0.51
187 0.43
188 0.36
189 0.3
190 0.27
191 0.26
192 0.23
193 0.23
194 0.19
195 0.19
196 0.17
197 0.17
198 0.18
199 0.14
200 0.13
201 0.19
202 0.2
203 0.22
204 0.22
205 0.23
206 0.23
207 0.25
208 0.25
209 0.22
210 0.24
211 0.25
212 0.28
213 0.3
214 0.32
215 0.29
216 0.3
217 0.27
218 0.24
219 0.27
220 0.28
221 0.29
222 0.33
223 0.36
224 0.37
225 0.37
226 0.35
227 0.29
228 0.25
229 0.22
230 0.17