Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SMG1

Protein Details
Accession A0A317SMG1    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
62-87RSSSKPPPTTGKRKENWKKREEERDLBasic
NLS Segment(s)
PositionSequence
73-80KRKENWKK
Subcellular Location(s) nucl 9, cyto 8, pero 4, mito 3, extr 2
Family & Domain DBs
Amino Acid Sequences MFVGGEEQDWFSRVGVEATQNSRQMEDAGVPRPEKEALAVIDLESAVLDWRDSVGWENGCARSSSKPPPTTGKRKENWKKREEERDLYSSTGMPLCVLGGYRTASRRGGILITGNAAVPEVGYDMLLFLHTNDCIRRDYDAEVMELMNVVQYRYRTVPQLIALPRYHNQHRMIFTQELPVLYCTAPVPYFTRAQRISNPLRYQSRSLPTLLPLPVQYSYLNSAAAYQTTGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.12
3 0.16
4 0.2
5 0.25
6 0.3
7 0.32
8 0.32
9 0.31
10 0.3
11 0.26
12 0.22
13 0.22
14 0.21
15 0.23
16 0.26
17 0.26
18 0.26
19 0.27
20 0.27
21 0.22
22 0.2
23 0.18
24 0.15
25 0.17
26 0.17
27 0.14
28 0.14
29 0.13
30 0.12
31 0.07
32 0.06
33 0.05
34 0.05
35 0.05
36 0.04
37 0.05
38 0.05
39 0.06
40 0.09
41 0.12
42 0.12
43 0.14
44 0.17
45 0.17
46 0.18
47 0.18
48 0.17
49 0.17
50 0.22
51 0.3
52 0.35
53 0.37
54 0.39
55 0.48
56 0.56
57 0.63
58 0.67
59 0.68
60 0.66
61 0.74
62 0.81
63 0.82
64 0.83
65 0.8
66 0.79
67 0.77
68 0.82
69 0.78
70 0.74
71 0.69
72 0.63
73 0.57
74 0.49
75 0.42
76 0.31
77 0.24
78 0.18
79 0.13
80 0.08
81 0.07
82 0.06
83 0.05
84 0.05
85 0.04
86 0.05
87 0.06
88 0.08
89 0.1
90 0.12
91 0.12
92 0.12
93 0.12
94 0.12
95 0.11
96 0.1
97 0.09
98 0.08
99 0.08
100 0.08
101 0.07
102 0.06
103 0.06
104 0.05
105 0.04
106 0.03
107 0.03
108 0.03
109 0.03
110 0.03
111 0.03
112 0.03
113 0.03
114 0.03
115 0.03
116 0.04
117 0.05
118 0.06
119 0.07
120 0.08
121 0.09
122 0.1
123 0.11
124 0.12
125 0.14
126 0.16
127 0.16
128 0.15
129 0.14
130 0.14
131 0.12
132 0.1
133 0.08
134 0.06
135 0.05
136 0.05
137 0.06
138 0.07
139 0.09
140 0.12
141 0.13
142 0.15
143 0.16
144 0.19
145 0.18
146 0.25
147 0.24
148 0.27
149 0.26
150 0.28
151 0.29
152 0.33
153 0.35
154 0.35
155 0.38
156 0.39
157 0.41
158 0.4
159 0.42
160 0.38
161 0.35
162 0.34
163 0.31
164 0.25
165 0.23
166 0.21
167 0.18
168 0.15
169 0.15
170 0.11
171 0.12
172 0.11
173 0.12
174 0.15
175 0.16
176 0.22
177 0.22
178 0.31
179 0.31
180 0.35
181 0.4
182 0.45
183 0.51
184 0.54
185 0.58
186 0.57
187 0.62
188 0.63
189 0.61
190 0.6
191 0.58
192 0.51
193 0.49
194 0.43
195 0.38
196 0.39
197 0.36
198 0.3
199 0.24
200 0.25
201 0.23
202 0.23
203 0.21
204 0.18
205 0.21
206 0.2
207 0.19
208 0.16
209 0.17
210 0.17
211 0.17