Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SFS3

Protein Details
Accession A0A317SFS3   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25MSPRNHNHQKRRRRPLINPTGPKTSHydrophilic
NLS Segment(s)
PositionSequence
10-16KRRRRPL
Subcellular Location(s) nucl 17, cyto_nucl 13, mito 5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019310  Efg1  
Gene Ontology GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF10153  Efg1  
Amino Acid Sequences MSPRNHNHQKRRRRPLINPTGPKTSATHLKKKVRDLQRLLNNPCSSLPADVRVENERALSAFQSELSAVQCAAKDRSIAKRYHMVRFFGTLFSSSSPPCD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.9
3 0.91
4 0.91
5 0.88
6 0.82
7 0.78
8 0.69
9 0.61
10 0.52
11 0.45
12 0.44
13 0.42
14 0.46
15 0.49
16 0.57
17 0.6
18 0.66
19 0.71
20 0.7
21 0.74
22 0.7
23 0.7
24 0.7
25 0.74
26 0.69
27 0.68
28 0.58
29 0.5
30 0.44
31 0.37
32 0.28
33 0.21
34 0.18
35 0.14
36 0.15
37 0.15
38 0.17
39 0.16
40 0.17
41 0.15
42 0.15
43 0.11
44 0.1
45 0.1
46 0.08
47 0.07
48 0.06
49 0.06
50 0.06
51 0.06
52 0.07
53 0.07
54 0.07
55 0.06
56 0.07
57 0.08
58 0.1
59 0.12
60 0.12
61 0.13
62 0.17
63 0.26
64 0.31
65 0.32
66 0.34
67 0.41
68 0.44
69 0.52
70 0.53
71 0.47
72 0.43
73 0.46
74 0.43
75 0.36
76 0.33
77 0.25
78 0.22
79 0.21
80 0.22