Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A317SJV7

Protein Details
Accession A0A317SJV7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
24-56SLLSRKHQFRLERRYRRRAKLKFARPRLQKTVKHydrophilic
NLS Segment(s)
PositionSequence
28-51RKHQFRLERRYRRRAKLKFARPRL
Subcellular Location(s) nucl 11, mito 10.5, cyto_mito 7, plas 3
Family & Domain DBs
Amino Acid Sequences MFPTRALLTQKVYKAKKPWPPDFSLLSRKHQFRLERRYRRRAKLKFARPRLQKTVKLAQGVIISSVVIWAAFINDWGERGNKTVQPLRNWVSDLKKSFWSTPSRPELSKQPRTPSSSRSISEESGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.57
2 0.62
3 0.65
4 0.68
5 0.71
6 0.68
7 0.7
8 0.68
9 0.66
10 0.64
11 0.64
12 0.59
13 0.57
14 0.58
15 0.54
16 0.53
17 0.54
18 0.56
19 0.55
20 0.63
21 0.66
22 0.69
23 0.76
24 0.83
25 0.86
26 0.88
27 0.89
28 0.85
29 0.85
30 0.85
31 0.86
32 0.86
33 0.86
34 0.85
35 0.82
36 0.82
37 0.81
38 0.78
39 0.71
40 0.67
41 0.66
42 0.6
43 0.53
44 0.45
45 0.38
46 0.31
47 0.27
48 0.2
49 0.12
50 0.08
51 0.07
52 0.07
53 0.04
54 0.03
55 0.03
56 0.02
57 0.03
58 0.03
59 0.03
60 0.04
61 0.04
62 0.05
63 0.06
64 0.07
65 0.07
66 0.1
67 0.13
68 0.13
69 0.18
70 0.24
71 0.28
72 0.3
73 0.36
74 0.37
75 0.36
76 0.36
77 0.37
78 0.37
79 0.39
80 0.39
81 0.36
82 0.39
83 0.39
84 0.41
85 0.42
86 0.43
87 0.4
88 0.46
89 0.51
90 0.49
91 0.48
92 0.49
93 0.54
94 0.56
95 0.63
96 0.6
97 0.61
98 0.64
99 0.7
100 0.7
101 0.65
102 0.63
103 0.6
104 0.56
105 0.54
106 0.51