Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A317SFH6

Protein Details
Accession A0A317SFH6    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
80-123PLDLRPKKTRAIRRRLTKHEAGLKTLKQQKKLTHFPKRKYAIKVHydrophilic
NLS Segment(s)
PositionSequence
83-118LRPKKTRAIRRRLTKHEAGLKTLKQQKKLTHFPKRK
Subcellular Location(s) nucl 19.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGVKTSTLWTKSKTDLHKQLEDLKQELANLRVQKIAGGASSKLTKIHDVRKSIARVLTVINATQRQQLRIFYKGKKYLPLDLRPKKTRAIRRRLTKHEAGLKTLKQQKKLTHFPKRKYAIKVGLYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.54
3 0.58
4 0.62
5 0.63
6 0.62
7 0.65
8 0.63
9 0.58
10 0.5
11 0.42
12 0.36
13 0.32
14 0.31
15 0.23
16 0.23
17 0.21
18 0.21
19 0.2
20 0.19
21 0.18
22 0.17
23 0.15
24 0.11
25 0.11
26 0.1
27 0.11
28 0.13
29 0.13
30 0.13
31 0.14
32 0.18
33 0.21
34 0.29
35 0.32
36 0.34
37 0.37
38 0.42
39 0.43
40 0.4
41 0.37
42 0.29
43 0.24
44 0.21
45 0.2
46 0.15
47 0.13
48 0.12
49 0.12
50 0.12
51 0.16
52 0.16
53 0.16
54 0.17
55 0.21
56 0.22
57 0.27
58 0.32
59 0.32
60 0.39
61 0.44
62 0.44
63 0.46
64 0.46
65 0.48
66 0.5
67 0.54
68 0.57
69 0.59
70 0.66
71 0.64
72 0.64
73 0.63
74 0.65
75 0.67
76 0.66
77 0.68
78 0.69
79 0.75
80 0.83
81 0.84
82 0.83
83 0.78
84 0.76
85 0.75
86 0.67
87 0.62
88 0.58
89 0.52
90 0.53
91 0.57
92 0.53
93 0.52
94 0.56
95 0.6
96 0.62
97 0.71
98 0.73
99 0.75
100 0.8
101 0.79
102 0.84
103 0.83
104 0.82
105 0.79
106 0.78
107 0.76